Recombinant Silicibacter sp. ATP synthase subunit c (atpE)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will accommodate your request whenever possible.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance, as additional charges will apply.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point for your preparation.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag type, please specify it in your order, and we will prioritize its development based on your needs.
Synonyms
atpE; TM1040_2593; ATP synthase subunit c; ATP synthase F(0 sector subunit c; F-type ATPase subunit c; F-ATPase subunit c; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-74
Protein Length
full length protein
Species
Ruegeria sp. (strain TM1040) (Silicibacter sp.)
Target Names
atpE
Target Protein Sequence
MEGDLAYIGAGLAGMGTGIAALGVGNVAANFLAGALRNPSAAASQTATLFIGIAFAEALG
IFSFLVALLLMFAV
Uniprot No.
Target Background
Function
F(1)F(0) ATP synthase generates ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases are composed of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are connected via a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a key component of the F(0) channel, directly participating in proton translocation across the membrane. A homomeric c-ring, consisting of 10-14 subunits, forms the central stalk rotor element, interacting with the F(1) delta and epsilon subunits.
Database Links
KEGG: sit:TM1040_2593
STRING: 292414.TM1040_2593
Protein Families
ATPase C chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
