Recombinant Silicibacter sp. Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, should you have a specific format preference, kindly specify it in your order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributors for precise delivery estimates.
Note: Our proteins are routinely shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobD; TM1040_2585; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Ruegeria sp. (strain TM1040) (Silicibacter sp.)
Target Names
cobD
Target Protein Sequence
MSTAALLIPAMILDAAFGEPKWLWSRLPHPAVLMGKLVQALDDRLNEGDGRQVKGVIAVA VLVFVGLLLGWILSWFGSLVSVLIAAILIAQRSLIDHVRAVATGLQNDLDAGRSAVAMIV SRDTATMTGPQIARSAIESGAENFSDGVIAPAFWFLVAGLPGLLIYKLINTADSMIGYRT EAYEDFGWAAARLDDVLNILPARLSALLIALVTGRAGDWGEISADARKHRSPNAGWPEAA MARALGVALAGPRSYDGEMRPFAWVNASGSKSASAHSITRCCEVLWKSWGLALVLVVALG LLF
Uniprot No.

Target Background

Function
This protein catalyzes the conversion of cobyric acid to cobinamide by attaching aminopropanol to the F carboxylic group.
Database Links
Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of CobD in the cobalamin biosynthesis pathway?

    CobD serves as a critical enzyme in the nucleotide loop assembly (NLA) branch of the adenosylcobalamin (AdoCba) biosynthesis pathway. Specifically, CobD functions as an L-threonine-O-3-phosphate decarboxylase (EC 4.1.1.81) in Salmonella enterica, known as CobC in the late-cobalt insertion pathway. This enzyme catalyzes the decarboxylation of L-threonine-O-3-phosphate, which is essential for producing the aminopropanol moiety of cobamides . The position of CobD within the pathway varies depending on whether the organism uses the anaerobic (early cobalt insertion) or aerobic (late cobalt insertion) pathway for cobalamin biosynthesis.

  • What is unique about Silicibacter sp. in relation to cobalamin biosynthesis?

    Silicibacter sp., particularly Silicibacter pomeroyi, belongs to the Roseobacter clade of alpha-proteobacteria, which constitutes 10-20% of coastal and oceanic bacterioplankton . What makes this organism particularly interesting is its ecological context - it was originally isolated from dinoflagellate cultures (specifically Pfiesteria piscicida) and participates in a symbiotic relationship with its dinoflagellate host . This relationship may involve nutrient exchange, potentially including B vitamins like cobalamin, which many marine microorganisms require but cannot synthesize independently . Genomic sequencing of Silicibacter has revealed specific adaptations to the marine environment and pathways for cobalamin biosynthesis that could support this symbiotic relationship .

  • What expression systems are recommended for producing recombinant Silicibacter CobD?

    Based on current research methodologies, E. coli-based expression systems are most commonly utilized for producing recombinant Silicibacter CobD protein. The recombinant protein is typically expressed with an N-terminal His-tag to facilitate purification . The experimental protocol includes:

    • Transformation of E. coli BL21(DE3) with the expression vector containing the cobD gene

    • Culture in LB medium supplemented with appropriate antibiotics (typically ampicillin at 0.1 mg/ml)

    • Induction at OD600 of 0.8-1.0 using 0.5 mM IPTG

    • Expression at reduced temperature (18°C) for 16 hours to enhance proper folding

    • Cell lysis using mechanical disruption (pressure crusher)

    • Purification via Ni2+-NTA affinity chromatography followed by gel filtration on a Superdex G75 column

    This methodology has been demonstrated to produce functional recombinant CobD with greater than 90% purity as determined by SDS-PAGE .

  • How should recombinant CobD protein be stored for optimal stability?

    For optimal stability of recombinant Silicibacter CobD protein, the following storage conditions are recommended:

    Storage TermTemperatureBuffer CompositionSpecial Considerations
    Short-term (1 week)4°CTris/PBS-based buffer, pH 8.0Working aliquots only
    Medium-term-20°CTris-based buffer with 50% glycerolAvoid repeated freeze-thaw cycles
    Long-term-80°CTris-based buffer with 6% Trehalose, pH 8.0Aliquot before freezing

    When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL. The addition of 5-50% glycerol (final concentration) is recommended before aliquoting for long-term storage to prevent protein degradation through freeze-thaw cycles .

Intermediate Research Questions

  • What experimental approaches are most effective for studying CobD enzymatic activity?

    Studying CobD enzymatic activity effectively requires a multi-faceted approach:

    1. Heterologous expression systems: Salmonella Typhimurium has proven to be an excellent tool for heterologous expression of putative adenosylcobalamin biosynthetic genes from other organisms. This approach, combined with mutagenesis and other genetic and biochemical techniques, has enabled the identification of all major enzymes involved in the NLA steps of the pathway .

    2. Feeding experiments: Transport and salvaging of incomplete corrinoids (e.g., cobinamide and cobyric acid) and complete cobamides (e.g., cobalamin) occurs under both aerobic and anaerobic conditions, allowing researchers to feed intermediates for phenotypic evaluation of specific mutations in the pathway .

    3. Isothermal titration calorimetry (ITC): This technique can be used to measure binding affinities and thermodynamic parameters of CobD interactions with substrates and cofactors. Measurements are typically performed at 25°C using a MicroCal iTC200 system or similar equipment .

    4. Site-directed mutagenesis: PCR-based methods can be used to introduce specific mutations in the cobD gene, with the mutant proteins subsequently produced in E. coli expression systems. This approach allows for the identification of key residues involved in catalysis or substrate binding .

    5. Complementation assays: These can determine whether recombinant CobD can restore cobalamin biosynthesis in CobD-deficient bacterial strains, confirming functional activity of the recombinant protein.

  • How does the CobD from Silicibacter sp. compare structurally and functionally to CobD homologs from other bacteria?

    Comparative analysis reveals several noteworthy differences between CobD from Silicibacter sp. and homologs from other bacteria:

    OrganismStructural FeaturesFunctional CharacteristicsEvolutionary Context
    Silicibacter pomeroyiContains 306 amino acids; typical PLP-dependent decarboxylase foldFunctions in late steps of AdoCba biosynthesisMember of Rhodobacterales, marine adaptation
    Methanosarcina mazeiC-terminus is a cysteine (unusual feature)Does not incorporate Zn unlike other homologsArchaeal variant with distinct properties
    Salmonella TyphimuriumWell-characterized homolog (CobD)Functions in anaerobic (early cobalt insertion) pathwayModel organism for cobalamin biosynthesis
    Mycobacterium tuberculosis313 amino acid lengthPotential virulence factorPathogen-specific adaptations

    These variations reflect adaptations to different ecological niches and metabolic requirements. For example, CobD from Silicibacter pomeroyi may have specific adaptations for marine environments, while the M. mazei variant shows unusual features possibly related to the archaeal lifestyle .

  • What are the key features of the cobD gene in the Silicibacter genome context?

    Within the genomic context of Silicibacter sp., the cobD gene exhibits several important features:

    In Silicibacter pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3), the cobD gene is designated by the ordered locus name SPO3225 . The gene encodes a full-length protein of 306 amino acids. The genomic context suggests that cobD is part of a cobalamin biosynthetic operon, similar to what has been observed in other bacteria like Bacillus megaterium, where 14 genes constitute a cobalamin biosynthetic (cob) operon .

    The Silicibacter genome has been fully sequenced, revealing adaptations to the marine environment . Particularly interesting is that the Silicibacter sp. strain TM1040 genome contains five putative prophages , demonstrating the complex evolutionary history of this organism through horizontal gene transfer, which may have influenced the evolution of metabolic pathways, including cobalamin biosynthesis.

    Based on genetic markers, Silicibacter sp. appears to utilize the late-cobalt insertion pathway of cobalamin biosynthesis, which is characteristic of alpha-Proteobacteria and functions under both aerobic and anaerobic conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.