Recombinant Silicibacter sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Introduction to PlsY and Its Recombinant Form

Glycerol-3-phosphate acyltransferase (GPAT), encoded by the plsY gene, catalyzes the first committed step in glycerolipid biosynthesis: transferring acyl groups from acyl-CoA or acyl-ACP to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA) or 2-monoacylglycerol (2-MAG) . Recombinant PlsY proteins are engineered to study enzyme structure, substrate specificity, and lipid metabolism mechanisms. In Silicibacter sp., PlsY is critical for membrane lipid synthesis and potentially symbiotic interactions with marine algae .

Catalytic Mechanism

PlsY transfers acyl groups to G3P, forming intermediates for phospholipid or triacylglycerol biosynthesis:

Acyl-CoA+sn-G3P1-acyl-sn-G3P+CoA\text{Acyl-CoA} + \text{sn-G3P} \rightarrow \text{1-acyl-sn-G3P} + \text{CoA}

In Silicibacter sp., this enzyme exhibits sn-2 acyltransferase activity and phosphatase activity, converting LPA to 2-MAG .

Substrate Preferences

Studies on related GPATs (e.g., Arabidopsis GPAT4/6) reveal a preference for unsaturated fatty acyl-CoAs, such as eicosapentaenoyl groups . Recombinant PlsY may share this specificity, though direct data for Silicibacter remains limited.

Recombinant Protein Utilization

Recombinant PlsY is used in:

  1. ELISA Kits: Detecting PlsY expression levels in bacterial cultures or symbiotic systems .

  2. Structural Studies: Mapping conserved motifs and active sites via crystallography.

  3. Lipid Engineering: Modulating membrane lipid composition in biotechnological applications.

Genetic and Functional Studies

  • Silicibacter sp. TM1040: PlsY mutants impair symbiosis with dinoflagellates, highlighting its role in biofilm formation and host interaction .

  • Comparative Genomics: Phylogenetic analysis links PlsY to GPATs in other marine bacteria, suggesting conserved roles in lipid metabolism .

Technical Challenges

  • Purification: Recombinant PlsY requires specialized detergents (e.g., 6-cyclohexyl-1-hexyl-β-d-maltoside) to maintain activity .

  • Stability: Repeated freeze-thaw cycles degrade activity; storage at -80°C is recommended .

Research Gaps

  • Substrate Specificity: Limited data on acyl-CoA preferences for Silicibacter PlsY.

  • Symbiotic Roles: Mechanism of PlsY in lipid transfer between Silicibacter and host algae remains unclear.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your requirement when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development with your specified tag.
Synonyms
plsY; TM1040_3073; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Ruegeria sp. (strain TM1040) (Silicibacter sp.)
Target Names
plsY
Target Protein Sequence
MLPALETTLPLLLFWGGIGYLLGSVPFGMVITRAFGLGNLREIGSGNIGTTNVLRTGSKA AAAATLLLDGGKGAAAVLLARALAGEDAAQLAGLLAFLGHCFPVWLGFKGGKGVATFLGL MLALAWPVGIACCLTWLGVAVLRRISSLAALCAAVAAPVWCLLLGAPQAAVLSALLALVI LWRHRENIARLRAGTEPKIGQK
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of glycerol-3-phosphate acyltransferase (plsY) in bacterial membrane phospholipid biosynthesis?

PlsY catalyzes a critical step in the most widely distributed biosynthetic pathway for bacterial membrane phospholipid formation. It transfers acyl groups from acylphosphate to glycerol-3-phosphate, initiating phosphatidic acid formation. This process typically works in conjunction with PlsX, which converts acyl-acyl carrier protein to acylphosphate prior to the PlsY-catalyzed transfer reaction .

What are the key structural features of bacterial plsY proteins?

Based on studies of Streptococcus pneumoniae PlsY, the protein typically contains five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane. The protein contains three larger cytoplasmic domains, each containing a highly conserved sequence motif critical for catalysis . While Silicibacter sp. plsY hasn't been characterized as thoroughly, it likely shares similar membrane topology given the conserved nature of this enzyme family.

What conserved motifs are essential for plsY function?

Site-directed mutagenesis studies have identified three critical motifs in plsY with distinctive functions:

MotifKey ResiduesFunction
Motif 1Serine, ArginineEssential residues for catalytic activity
Motif 2Conserved GlycinesForms phosphate-binding loop; mutations result in defective glycerol-3-phosphate binding (Km defect)
Motif 3Histidine, Asparagine, GlutamateHistidine and asparagine important for activity; glutamate critical for structural integrity

These motifs are likely conserved across the PlsY family, including in Silicibacter species .

How can the membrane topology of recombinant plsY be determined experimentally?

The substituted cysteine accessibility method has proven effective for determining plsY membrane topology. This approach, successfully used with S. pneumoniae PlsY, involves systematically substituting residues with cysteine and assessing their accessibility to membrane-impermeable thiol-reactive reagents. This methodology revealed the five membrane-spanning segments and the orientation of loops relative to the membrane .

What expression systems are most suitable for producing recombinant Silicibacter sp. plsY?

While specific expression systems for Silicibacter sp. plsY aren't detailed in the literature, approaches used for related marine bacterial proteins may be applicable. For Silicibacter pomeroyi amine transaminase, expression in E. coli BL21(DE3) using pET vectors has proven successful. Optimization strategies include:

  • Using terrific broth (TB) supplemented with phosphate buffer

  • Inducing with 0.2 mM IPTG at OD600 of 0.6-1

  • Lowering expression temperature to 20°C after induction

  • Extended expression periods (20+ hours)

What purification strategies help maintain activity of membrane-bound acyltransferases like plsY?

Purification of integral membrane acyltransferases presents significant challenges. A breakthrough approach for the related enzyme PlsC involved using the detergent 6-cyclohexyl-1-hexyl-β-d-maltoside for solubilization and purification. This method successfully maintained enzymatic activity throughout the purification process, a significant achievement given that solubilization of such proteins typically leads to inactivation . Similar approaches may prove effective for Silicibacter sp. plsY.

What substrates does Silicibacter sp. plsY preferentially utilize?

While specific substrate preferences for Silicibacter sp. plsY have not been characterized in detail, insights can be gained from related marine bacterial acyltransferases. For instance, PlsC from the marine bacterium Shewanella livingstonensis Ac10 exhibits a substrate preference for acyl donors with polyunsaturated fatty acyl groups, particularly eicosapentaenoyl groups . Marine bacteria like Silicibacter species may have evolved specialized substrate preferences adapted to their unique ecological niches.

How do inhibitors affect plsY activity and what does this reveal about its mechanism?

Studies with S. pneumoniae PlsY revealed that palmitoyl-CoA acts as a noncompetitive inhibitor of the enzyme . This suggests that although palmitoyl-CoA is not a direct substrate for PlsY (which uses acylphosphate instead), it can bind to the enzyme at a site distinct from the active site and alter its catalytic efficiency. This inhibition pattern provides valuable insights into potential regulatory mechanisms of phospholipid biosynthesis in bacteria.

How can researchers measure plsY activity effectively in vitro?

While specific assays for Silicibacter sp. plsY are not detailed in the literature, acyltransferase activity is typically measured by tracking the transfer of labeled acyl groups to glycerol-3-phosphate. Critical controls should include:

  • Heat-inactivated enzyme (negative control)

  • Known inhibitors like palmitoyl-CoA

  • Substrate specificity testing with various acyl donors

  • pH and ionic strength optimization relevant to marine environments

How does plsY from Silicibacter compare to acyltransferases from other marine bacteria?

Marine bacteria exhibit remarkable diversity in their metabolic capabilities. A comparison of key genomic features across marine bacteria reveals distinctive characteristics of Silicibacter species:

FeaturePolaribacterPelagibacterSilicibacterProchlorococcus
Genome size (Mb)2.971.314.602.41
Pyruvate carboxylase1010
PEP carboxylase1111
Peptidases93163719
DMSP use-+++
Transporters10688429119

The significantly larger genome and extensive transporter system of Silicibacter suggest a more complex metabolic capability, potentially reflected in specialized enzymes like plsY .

What is the relationship between plsY and plsC in phospholipid biosynthesis?

PlsY and PlsC represent sequential enzymes in phospholipid biosynthesis:

  • PlsY (1-acyl-sn-glycerol-3-phosphate acyltransferase) initiates phosphatidic acid formation by transferring an acyl group from acylphosphate to glycerol-3-phosphate

  • PlsC (1-acyl-sn-glycerol-3-phosphate acyltransferase) catalyzes the subsequent acylation of lysophosphatidic acid

Both are integral membrane proteins essential for membrane phospholipid biosynthesis. While plsY catalyzes the first acylation step, plsC is responsible for the second acylation, completing phosphatidic acid formation, which serves as a precursor for various membrane glycerophospholipids .

How has plsY evolved to function in marine environments like those inhabited by Silicibacter species?

Silicibacter species belong to the Roseobacter clade, which comprises approximately 10-20% of coastal and oceanic mixed-layer bacterioplankton . These bacteria have evolved specialized adaptations to marine environments, including genes for uptake of algal-derived compounds, use of metabolites from reducing microzones, and cell-density-dependent regulation . The membrane-associated enzymes like plsY likely reflect adaptations to marine conditions, potentially including salt tolerance, temperature adaptations, and specialized substrate preferences aligned with available marine nutrients.

How does the ecological niche of Silicibacter sp. potentially influence plsY function?

Silicibacter species form important associations with marine dinoflagellates, with strains like TM1040 exhibiting an 'obligate' interaction required for normal dinoflagellate growth in laboratory cultures . These bacteria metabolize dimethylsulfoniopropionate (DMSP) produced by dinoflagellates . The membrane composition, influenced by plsY activity, likely plays a crucial role in this symbiotic relationship, potentially facilitating attachment to dinoflagellate surfaces and adaptation to the chemical environment created by these hosts.

How might recombinant plsY be used to investigate bacterial adaptation to marine environments?

Recombinant plsY could serve as a valuable tool to study how membrane lipid composition contributes to marine bacterial adaptation. Potential research applications include:

  • Comparing kinetic parameters and substrate preferences of plsY from different marine bacteria

  • Investigating temperature and salinity effects on enzyme activity

  • Engineering membrane composition by manipulating plsY expression or altering its substrate specificity

  • Exploring the role of membrane phospholipids in bacterial-dinoflagellate symbiosis

What potential does plsY hold as an antimicrobial target?

As an essential enzyme in bacterial phospholipid biosynthesis, plsY represents a promising antimicrobial target. The detailed characterization of active site residues provides a foundation for structure-based drug design. The noncompetitive inhibition by palmitoyl-CoA suggests alternative inhibitory mechanisms beyond active site targeting. Since the PlsX-PlsY pathway is the most widely distributed biosynthetic pathway for initiating phosphatidic acid formation in bacteria , inhibitors could potentially have broad-spectrum activity.

What are the major technical challenges in working with recombinant plsY?

As an integral membrane protein, plsY presents several significant challenges:

  • Achieving proper membrane insertion during heterologous expression

  • Preventing aggregation during solubilization and purification

  • Maintaining enzymatic activity throughout purification

  • Establishing reliable activity assays that account for the membrane-associated nature of the enzyme

The difficulties in solubilizing such proteins without causing inactivation have hampered detailed biochemical characterization despite their physiological importance .

How can researchers address protein stability issues with marine bacterial enzymes like Silicibacter sp. plsY?

Studies on thermostability enhancement of Silicibacter pomeroyi enzymes offer relevant insights. Approaches include:

  • Homology modeling to identify stabilizing mutations

  • Analysis of ancestral sequences to identify thermostabilizing residues

  • Differential scanning fluorimetry to assess melting temperatures

  • Circular dichroism to analyze secondary structure stability

  • Half-life determinations at various temperatures to quantify stability improvements

These methods have successfully enhanced the thermostability of other Silicibacter enzymes and may be applicable to plsY .

What considerations are important when designing mutagenesis studies for plsY?

Based on successful studies with S. pneumoniae PlsY, effective mutagenesis approaches should:

  • Target conserved residues within the three key motifs

  • Assess mutations of glycines in motif 2 to evaluate glycerol-3-phosphate binding

  • Examine the role of histidine and asparagine in motif 3 for catalytic activity

  • Investigate glutamate residues in motif 3 for structural integrity

  • Use conservative substitutions to distinguish between structural and catalytic roles

How might genomic approaches advance our understanding of plsY function in marine bacteria?

The genome sequence of Silicibacter pomeroyi reveals adaptations to the marine environment, including a chromosome (4,109,442 base pairs) and megaplasmid (491,611 base pairs) . Comparative genomic analyses across the Roseobacter clade could identify variations in plsY and related phospholipid biosynthesis genes that correlate with ecological niches or symbiotic relationships. Transcriptomic studies could reveal how plsY expression responds to environmental conditions relevant to marine ecosystems.

What novel functional assays could advance characterization of recombinant Silicibacter sp. plsY?

Future research might develop:

How might studying plsY contribute to understanding bacterial-dinoflagellate symbiosis?

Research on Silicibacter sp. TM1040 has shown that bacterial motility is important for establishing interactions with the dinoflagellate Pfiesteria piscicida . The membrane composition, influenced by plsY activity, likely affects bacterial motility, attachment capabilities, and signaling processes. Investigating how phospholipid composition influences these functions could provide deeper insights into the molecular basis of these ecologically important symbiotic relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.