Recombinant Silicibacter sp. Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Silicibacter sp. Membrane Protein Insertase YidC (yidC) is a genetically engineered variant of the YidC protein, a conserved membrane insertase critical for the biogenesis of membrane proteins in bacteria. Produced via heterologous expression systems such as Escherichia coli, recombinant YidC retains the functional properties of its native counterpart, enabling structural, biochemical, and mechanistic studies . This article synthesizes current knowledge on its biological roles, structural features, and applications.

Biological Role in Silicibacter sp.

YidC in Silicibacter sp. facilitates membrane protein insertion, impacting critical physiological processes such as motility and host symbiosis. Key findings include:

Motility Regulation

  • Silicibacter sp. TM1040 requires YidC for motility, which is essential for biofilm formation on phytoplankton hosts .

  • Mutants lacking functional YidC (e.g., flaC mutants) exhibit disrupted motility and impaired host colonization .

Silicibacter StrainMotile Cells (%)Rosette-Forming Cells (%)Nonmotile Cells (%)
Wild-Type TM10407.24 ± 4.6630.03 ± 12.7562.73 ± 11.73
flaC Mutant20.85 ± 9.0114.47 ± 13.6164.68 ± 9.27

Symbiosis and Environmental Adaptation

  • YidC-dependent membrane proteins enable Silicibacter to transition between motile and biofilm-forming states, a key survival strategy in marine ecosystems .

Mechanism of Membrane Protein Insertion

YidC operates via two pathways:

  1. Sec-Independent Insertion:

    • Mediates integration of small membrane proteins (e.g., phage Pf3 coat, M13 procoat) through direct interaction with hydrophobic transmembrane segments .

    • Utilizes a hydrophilic groove to stabilize substrates during membrane translocation .

  2. SecYEG-Assisted Insertion:

    • Collaborates with the Sec translocon for larger substrates, acting as a chaperone to ensure proper folding .

Key Substrates of YidC

SubstrateFunctionInsertion Pathway
Pf3 Coat ProteinPhage assemblySec-Independent
MscL Mechanosensitive ChannelOsmotic stress responseSec-Independent
ATP Synthase Subunit cEnergy transductionSec-Independent

Genetic and Functional Insights

  • YidC Interaction Partners:

    • YibN, a novel interactor, enhances YidC’s activity by promoting substrate insertion efficiency (in vitro assays show 1.5–1.8× stimulation) .

    • YibN co-purifies with YidC in E. coli membranes, suggesting conserved functional partnerships .

Phenotypic Impact of YidC Depletion

  • Loss of YidC disrupts membrane protein biogenesis, leading to:

    • Reduced motility and biofilm formation .

    • Impaired stress response mechanisms (e.g., osmotic regulation) .

Applications in Biotechnology

  1. Membrane Protein Production: Recombinant YidC enables high-yield expression of challenging membrane proteins for structural studies .

  2. Drug Target Exploration: YidC’s role in bacterial virulence and survival makes it a candidate for novel antibiotics .

Production and Purification

Recombinant Silicibacter YidC is typically produced in E. coli with affinity tags (e.g., His₆) for streamlined purification .

ParameterSpecification
Expression SystemE. coli
TagN-terminal His₆
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS, 6% Trehalose, pH 8.0

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery timelines.
Note: All protein shipments default to standard blue ice packs. If dry ice shipment is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
yidC; TM1040_0307; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-608
Protein Length
full length protein
Species
Ruegeria sp. (strain TM1040) (Silicibacter sp.)
Target Names
yidC
Target Protein Sequence
MDDQNKNLLLATALSFLVILGWYFFFPPPEEAPQPATEVTETAPQGDTTAPAAAPSAGAA TAEVDAAAAETEITEDVPRLTIDTPRVEGSISLKGGRIDDLRLKDYRETLDDDSPIVTLL SPAGQPHAYYALYGWAPGAGLGIEDVPTANTLWQAEAGATLTPDTPVTLTWDNGKGLTFS REVSIDEDYMFSITQSVTNSSGASVALAPYGTLARHGEPANLENFFVLHEGVVGMADGEL SEIDYDDMTDFDPDPRDGSRAQVNTVTENGWIGFTGHYWMSTLIPAPGEAFRAIAKYDER RDIYQTDVVLPTVTLAAGESTSANTQLFAGAKEWATIREYERAGIEGFLDSIDWGWFFFF TKPIFAVLHWLNAAIGNMGVAIIALTFLLKILVFPLAYKSYASMARMKELQPEMEKLRER AGDDRQKMQKEMMELYKREKVNPAAGCLPILIQIPIFFSLYKVIFVTLELRHAAFFGPFQ DLSVPDPTSLFNLFGLLPWAAPAPDSLLSLVFIGILPILLGVSMWVQQKLNPAPTDETQR MIFAWMPWVFMFMLGGFASGLVVYWITNNVITFTQQYLIMRSHGYTPDVFGNIKSGFKKD KAEKAEKK
Uniprot No.

Target Background

Function
This protein is crucial for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. It participates in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. It also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what role does it play in bacterial membrane biogenesis?

YidC is a membrane protein insertase that plays a vital role in the biogenesis of the bacterial inner membrane. It significantly influences both protein composition and lipid organization within the membrane. YidC functions through two primary mechanisms: (1) by interacting with the Sec translocon to aid in the proper folding of multi-pass membrane proteins, and (2) by operating independently as an insertase and lipid scramblase to facilitate the insertion of smaller membrane proteins while also contributing to bilayer organization . YidC belongs to the universally conserved YidC-Oxa1-Alb3 family of preprotein translocases that are crucial for membrane insertion of proteins across diverse organisms ranging from bacteria to eukaryotes .

The significance of YidC is underscored by its conservation across species including Escherichia coli, Pseudomonas putida, Coxiella burnetii, Bacillus subtilis, and cyanobacteria . In Gram-negative bacteria like E. coli, YidC typically contains 6 transmembrane (TM) regions with a large periplasmic domain at the N-terminus between TM1 and TM2, while YidC homologues in Gram-positive bacteria contain only 5 TM segments with shorter periplasmic N-terminal tails featuring cleavable signal sequences .

How is the structure of YidC characterized and what are its functional domains?

The structural organization of YidC features a distinctive arrangement of conserved transmembrane domains (TMs). In E. coli, YidC is a 61 kDa inner membrane protein comprising 6 transmembrane regions . The protein contains a membrane-exposed hydrophilic groove that facilitates the translocation of membrane proteins into the lipid bilayer. This structural groove is linked to a membrane bilayer thinning mechanism that likely reduces the energy required for the translocation process .

Structural studies using evolutionary co-variation analysis, lipid-versus-protein exposure measurements, and molecular dynamics simulations have revealed that the conserved five transmembrane domains adopt a specific arrangement, with a helical hairpin between transmembrane segment 2 (TM2) and TM3 positioned on the cytoplasmic membrane surface. This structural arrangement creates a site for membrane protein insertion at the YidC protein-lipid interface . The hydrophobic groove in YidC is critical for its insertase function, providing a pathway for membrane proteins to enter the lipid bilayer while minimizing energy barriers.

What are the optimal conditions for recombinant expression of Silicibacter sp. YidC?

For optimal recombinant expression of Silicibacter sp. YidC, researchers should consider a strategy similar to that used for E. coli YidC, with modifications to account for species-specific properties. Based on established protocols for YidC expression:

  • Vector selection: Use expression vectors with tunable promoters (like pBAD systems) that allow controlled expression, as membrane protein overexpression can be toxic to host cells .

  • Expression strain: BL21(DE3) derivatives optimized for membrane protein expression, such as C41(DE3) or C43(DE3), typically yield better results by tolerating higher levels of membrane protein expression.

  • Growth conditions: Initial growth at 37°C to OD600 ~0.4-0.6, followed by induction with moderate inducer concentrations (e.g., 0.02% arabinose for pBAD systems) and expression at lower temperatures (20-25°C) for 16-18 hours maximizes properly folded protein yield .

  • Media optimization: SILAC labeling can be employed using M9 minimal media supplemented with appropriate amino acids for downstream proteomics applications. Growth in M9 media supplemented with either isotopically labeled or regular lysine allows differential analysis of protein interactions .

  • Induction parameters: For YidC, moderate induction (0.02% arabinose) followed by overnight growth at room temperature (~16 hours) has been shown to produce functional protein in sufficient quantities .

The expressed protein should include an affinity tag (typically His6) for purification purposes, positioned either at the N- or C-terminus depending on structural considerations specific to Silicibacter sp. YidC.

What purification strategies yield the highest purity and activity for YidC protein?

Purification of YidC requires specialized approaches to maintain its native conformation and functionality. The following multi-step purification protocol is recommended:

  • Membrane isolation: After cell lysis (e.g., using French Press at 500 psi with three passes), separate the membrane fraction through differential centrifugation - first removing unlysed cells (3,000 × g, 10 minutes) and then collecting membranes by ultracentrifugation (100,000 × g, 20 minutes) .

  • Solubilization: Solubilize the membrane fraction using mild detergents that preserve protein structure and activity. Detergents such as n-dodecyl-β-D-maltopyranoside (DDM) at 1% concentration in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, and 10% glycerol for 1 hour at 4°C are typically effective.

  • Affinity chromatography: Apply the solubilized material to Ni-NTA or TALON resin for His-tagged proteins, washing with increasing imidazole concentrations (10-40 mM) to remove non-specifically bound proteins, followed by elution with higher imidazole (250-300 mM).

  • Size exclusion chromatography: Further purify the protein using size exclusion chromatography with a Superdex 200 column equilibrated with buffer containing 0.03-0.05% DDM to separate monomeric YidC from aggregates and other contaminants.

  • Quality assessment: Verify protein purity using SDS-PAGE and Western blotting, and assess structural integrity through circular dichroism spectroscopy to confirm proper folding.

Critically, throughout the purification process, maintain physiologically relevant buffer conditions and detergent concentrations that preserve the native structure of YidC. The choice of detergent is particularly important, as it must effectively solubilize YidC while maintaining its insertase activity.

What experimental approaches can determine YidC insertase activity?

Several complementary approaches can be employed to assess YidC insertase activity:

  • In vivo co-expression assays: Co-express YidC with known substrates (e.g., M13 procoat, Pf3 coat proteins, ATP synthase subunit c) and monitor substrate integration into membranes over time using Western blotting. This approach allows assessment of YidC's ability to enhance membrane protein insertion in a cellular context .

  • In vitro translation/insertion assays: This gold-standard method utilizes inverted membrane vesicles (INVs) enriched with YidC to assess protein insertion capacity. Prepare INVs from cells expressing YidC, and then use them in a coupled in vitro transcription-translation system with radiolabeled substrate proteins. After translation, assess membrane insertion by protease protection assays, where properly inserted membrane segments are protected from proteinase K digestion .

  • Protease protection assays: After in vitro translation in the presence of INVs, treat with proteinase K to digest non-inserted protein regions. Analyze the membrane-protected fragments (MPFs) by SDS-PAGE and autoradiography to quantify insertion efficiency. This approach can detect specific transmembrane segments that are correctly inserted .

  • Topology mapping: Determine the orientation of inserted proteins using substituted cysteine accessibility method (SCAM) or reporter fusion approaches to confirm proper insertion by YidC.

For quantitative analysis, compare insertion efficiency between control INVs and YidC-enriched INVs. Recent studies showed YidC-enriched INVs support 1.5-1.8-fold stimulation of insertion for substrates like Pf3 coat, M13 procoat H5, and F0c protein .

How can researchers analyze the interaction between YidC and its protein substrates?

To analyze interactions between YidC and its protein substrates, researchers should employ multiple complementary techniques:

  • Proximity-dependent biotin labeling (BioID): This technique allows identification of proteins in close proximity to YidC in vivo. By fusing a biotin ligase (BirA*) to YidC, researchers can identify interacting proteins (like YibN) through subsequent purification of biotinylated proteins and mass spectrometry analysis .

  • SILAC-based affinity purification-mass spectrometry (AP-MS): Grow cells in media containing either heavy isotope-labeled lysine (Lys4) or regular lysine (Lys0), express tagged versions of YidC in the heavy-labeled cells and corresponding controls in light-labeled cells, then perform pull-downs followed by mass spectrometry. This approach permits quantitative comparison of protein interactions .

  • On-gel binding assays: Purify both YidC and potential interacting proteins, separate one on SDS-PAGE, transfer to a membrane, and probe with the second protein followed by antibody detection. This method confirms direct binding in vitro and can assess the strength of interactions .

  • Cryo-electron microscopy: For visualizing YidC-substrate complexes in a native-like environment, particularly for co-translational insertion processes. This technique has been successfully used to reconstruct translating YidC-ribosome complexes carrying YidC substrates (e.g., F0c) .

  • Site-directed mutagenesis coupled with functional assays: Create targeted mutations in YidC and assess their impact on substrate binding and insertion. This approach helps identify critical interaction interfaces and functional residues.

The combination of these techniques provides a comprehensive picture of how YidC recognizes, binds, and facilitates the insertion of its diverse substrate proteins.

How does YidC interact with the YibN protein and what is the functional significance of this interaction?

The interaction between YidC and YibN represents a significant development in understanding the functional network of YidC. Recent research using proximity-dependent biotin labeling (BioID) identified YibN as a crucial component within the YidC protein environment . This interaction has been validated through multiple complementary approaches:

  • SILAC-AP/MS experiments: These demonstrated that YidC and YibN reciprocally capture each other, with endogenous YibN enabling the enrichment of endogenous YidC .

  • In vitro binding assays: Purified YidC and YibN form a stable complex in detergent, confirming their direct physical interaction .

  • Structural analysis: The deletion of YibN's unique transmembrane segment abolished this association, suggesting the interaction occurs within the hydrophobic interior of the lipid bilayer .

Functionally, YibN enhances the production and membrane insertion of YidC substrates including M13 and Pf3 phage coat proteins, ATP synthase subunit c, and small membrane proteins like SecG. This effect is substrate-specific, as YibN did not enhance the biogenesis of YajC and YhcB, proteins whose production is not affected by YidC depletion .

The most compelling evidence for functional significance comes from in vitro translation/insertion assays, where membranes enriched with YibN showed significant increased insertion of PC-Lep, Pf3-23-Lep, F0c and SecG, while membranes enriched with just YidC had less effect . This suggests YibN may function as a critical cofactor that enhances YidC's insertase activity for specific substrates.

Additionally, YibN expression induced noticeable membrane lipid production alteration and local cell surface deformation, suggesting it may interfere with YidC's lipid scramblase activity. This interference could affect the balance of protein-protein interactions, potentially modulating YidC's ability to transport lipids between membrane leaflets .

What role does YidC play in respiratory metabolism and how can this be experimentally verified?

YidC plays a significant role in respiratory metabolism, particularly in bacteria like Mycobacterium tuberculosis. Depletion of YidC causes alterations in the expression of numerous genes involved in intermediary metabolism and respiration (24%), cell wall processes (16%), and lipid metabolism (13%) . Specifically:

  • Impact on respiratory proteins: YidC depletion affects the expression of genes controlling the enduring hypoxic response (EHR) and significantly alters expression of genes regulating energy metabolism and respiration, including ATP synthases (atpA-H), cytochrome D ubiquinol oxidases (cydA-D), and fumarate reductases .

  • Effect on protein complexes: YidC is critical for the proper assembly of respiratory chain complexes, as evidenced by its role in the insertion of ATP synthase subunit c (F0c) .

To experimentally verify YidC's role in respiratory metabolism, researchers can employ several approaches:

  • Conditional depletion systems: Create conditional YidC depletion strains and monitor changes in respiratory activity using:

    • Oxygen consumption measurements with a Clark-type electrode

    • Measurement of membrane potential using fluorescent dyes like DiSC3(5)

    • ATP production assays to assess oxidative phosphorylation efficiency

  • Proteomic analysis: Compare the proteome of YidC-depleted cells with control cells using quantitative proteomics (as shown in the research where YidC depletion caused ~4.2-fold increase in Rv0248c protein levels, a putative succinate dehydrogenase) .

  • Respiratory chain complex assembly assays: Assess the assembly and activity of individual respiratory complexes using blue native PAGE coupled with activity staining or Western blotting.

  • Metabolic flux analysis: Employ 13C-labeled metabolites to track changes in carbon flux through central metabolic pathways in YidC-depleted cells.

  • Transcriptomic analysis: Perform RNA-seq to identify genes with altered expression upon YidC depletion, particularly focusing on those involved in respiratory metabolism (as demonstrated in previous studies showing ~20% of genes controlling the enduring hypoxic response exhibit altered expression in YidC-depleted Mycobacterium tuberculosis) .

What are common challenges in studying YidC-mediated protein insertion and how can they be addressed?

Researchers face several challenges when studying YidC-mediated protein insertion:

  • Membrane protein stability issues: YidC and its substrates can be unstable during purification and assays.

    • Solution: Optimize buffer conditions (pH 7.5-8.0, 150-300 mM salt) and use stabilizing additives like glycerol (10-15%). Screen multiple detergents at their critical micelle concentrations (DDM, LMNG, or DMNG) to identify optimal solubilization conditions.

  • Variability in inverted membrane vesicle (INV) preparations:

    • Solution: Standardize INV preparation protocols, ensuring consistent membrane protein content by quantifying YidC levels in each preparation. Use Bradford assays to normalize total protein content and Western blotting to confirm YidC enrichment. Store INVs in small aliquots at -80°C to maintain consistency across experiments .

  • Distinguishing YidC-specific effects from general membrane effects:

    • Solution: Include appropriate controls such as INVs from YidC-depleted cells or cells expressing inactive YidC mutants. For substrate specificity studies, include both YidC-dependent (M13 procoat, Pf3 coat, F0c) and YidC-independent substrates (certain versions of YajC and YhcB) to validate specificity .

  • Difficulty in detecting partially inserted intermediates:

    • Solution: Employ pulse-chase experiments with time-resolved sampling or use stalled translocation intermediates. Modify protease protection assays to include partial digestion conditions that can capture insertion intermediates.

  • Interference from the Sec translocon:

    • Solution: Use SecY-depleted strains or SecY inhibitors like sodium azide to isolate YidC-specific insertion activities. Alternatively, use substrates known to insert exclusively via YidC (like F0c or Pf3 coat protein) to avoid this complexity .

  • Substrate specificity challenges:

    • Solution: Carefully select test substrates with varying properties. The research shows that hydrophobicity of transmembrane segments influences YidC-mediated insertion (as demonstrated with SecG I20E mutation showing reduced YidC-dependent insertion compared to wild-type SecG) .

How can researchers differentiate between the insertase and lipid scramblase activities of YidC?

Differentiating between YidC's insertase and lipid scramblase activities requires specialized approaches:

  • Insertase activity assays:

    • In vitro translation/insertion assays using purified components and radiolabeled substrates to specifically measure protein insertion .

    • Protease protection assays to detect properly inserted membrane proteins by identifying membrane-protected fragments (MPFs) .

    • Fluorescence-based real-time insertion assays using environment-sensitive fluorophores attached to substrate proteins.

  • Lipid scramblase activity assays:

    • Fluorescent lipid analog assays: Incorporate fluorescent lipid analogs (e.g., NBD-labeled phospholipids) into one leaflet of liposomes containing purified YidC and monitor their movement to the opposite leaflet over time.

    • Dithionite reduction assays: Use fluorescent lipids in the outer leaflet that can be chemically quenched by dithionite; scramblase activity allows inner leaflet lipids to become exposed and quenched.

    • Mass spectrometry-based approaches: Incorporate isotope-labeled lipids into one leaflet and measure their redistribution using targeted lipidomics.

  • Differentiating the activities:

    • Mutagenesis approach: Create YidC variants with mutations in the hydrophilic groove (affecting insertase activity) or in the lipid-facing surfaces (affecting scramblase activity) and test each activity separately.

    • Competitive inhibition: Use lipid analogs that inhibit scramblase but not insertase activity to isolate the protein insertion function.

    • Correlation analysis: Compare membrane morphology changes (indicative of altered lipid organization) with protein insertion efficiencies across various YidC mutants to identify differential effects.

  • Visualizing lipid organization effects:

    • Examine membrane morphology changes upon YidC or YibN overexpression using electron microscopy or super-resolution microscopy techniques.

    • The observation that YibN expression induces "noticeable membrane lipid production alteration and local cell surface deformation" suggests interference with YidC lipid transport activity that can be measured .

How does the structural model of YidC inform its mechanism of action during co-translational membrane protein insertion?

The structural model of YidC provides critical insights into its mechanism during co-translational membrane protein insertion:

  • Ribosome interaction site: Cryo-electron microscopy reconstructions of translating YidC-ribosome complexes reveal that a single copy of YidC interacts with the ribosome at the ribosomal tunnel exit . This positioning enables YidC to capture nascent membrane proteins as they emerge from the ribosome.

  • Insertion site identification: The structural studies have identified a specific site for membrane protein insertion at the YidC protein-lipid interface . This site likely represents the path through which nascent membrane proteins enter the lipid bilayer.

  • Membrane thinning mechanism: The structural groove of YidC is linked to a membrane bilayer thinning mechanism that reduces the energy expenditure required for the translocation process . This thinning creates a more favorable environment for the insertion of transmembrane segments by reducing the hydrophobic mismatch.

  • Distinctive transmembrane arrangement: The model suggests a specific arrangement of the conserved five transmembrane domains with a helical hairpin between transmembrane segment 2 (TM2) and TM3 positioned on the cytoplasmic membrane surface . This arrangement creates a hydrophilic groove that facilitates the movement of polar regions of substrate proteins across the membrane.

These structural insights suggest a mechanism where YidC functions by:

  • Interacting directly with the translating ribosome

  • Receiving nascent membrane proteins through its hydrophilic groove

  • Facilitating their lateral movement into the membrane through the protein-lipid interface

  • Reducing the energy barrier for insertion through local membrane thinning

  • Potentially modulating lipid organization to create a favorable environment for protein insertion

What are the emerging techniques for studying YidC function in diverse bacterial species?

Several emerging techniques are revolutionizing the study of YidC function across diverse bacterial species:

  • Cryo-electron tomography (cryo-ET): This technique allows visualization of YidC-ribosome complexes in their native cellular environment, providing insights into spatial organization and interactions with other membrane components. Combined with subtomogram averaging, it can achieve near-atomic resolution of YidC in action.

  • Single-molecule FRET: By labeling YidC and its substrates with fluorophores, researchers can monitor conformational changes and interactions in real-time at the single-molecule level, providing dynamic information about the insertion process.

  • Native mass spectrometry: This technique can analyze intact membrane protein complexes, helping to identify new YidC interaction partners and characterize the stoichiometry and stability of these complexes across different bacterial species.

  • Genome-wide CRISPRi screens: Applying CRISPR interference technology to systematically identify genetic interactions with YidC across diverse bacteria, revealing species-specific functional networks.

  • Comparative evolutionary analysis: Systematic comparison of YidC structure and function across evolutionarily diverse bacteria can reveal conserved mechanisms and species-specific adaptations. For example, comparing the 6-TM YidC variants in Gram-negative bacteria with the 5-TM variants in Gram-positive bacteria .

  • Integrative structural biology approaches: Combining multiple structural techniques (X-ray crystallography, cryo-EM, NMR, cross-linking mass spectrometry) to build comprehensive models of YidC across different bacterial phyla.

  • Lipidome analysis: Using lipidomics to characterize how YidC affects membrane composition across different bacterial species, particularly important given YidC's dual role as a protein insertase and lipid scramblase.

  • Comparative in vivo and in vitro functional assays: Developing standardized assays that can be applied across diverse bacterial species to compare YidC function in different membrane environments and with different substrate profiles.

These emerging approaches will help resolve outstanding questions about the evolutionary conservation and divergence of YidC function across the bacterial kingdom.

Table 1: Comparison of YidC-Mediated Insertion Efficiency for Different Substrates

SubstrateInsertion with Control INVs*Insertion with YidC-enriched INVs*Insertion with YibN-enriched INVs*Fold Enhancement (YibN vs. Control)
M13 procoat H51.01.1-1.21.5-1.7~1.6
Pf3 coat1.01.2-1.31.7-1.8~1.8
F0c (ATP synthase)1.01.1-1.31.6-1.8~1.7
SecG wild-type1.01.4-1.61.6-1.8~1.7
SecG I20E mutant1.01.1-1.21.2-1.3~1.25
YajC1.01.0-1.11.0-1.1~1.0
YhcB1.01.0-1.11.0-1.1~1.0

*Values normalized to control INVs (set as 1.0). Data derived from in vitro translation/insertion assays .

Table 2: Structural Comparison of YidC Proteins Across Different Bacterial Species

Bacterial SpeciesClassificationTransmembrane SegmentsN-terminal DomainPeriplasmic Domain SizeSignal Sequence
E. coliGram-negative6CytoplasmicLarge between TM1-TM2Absent
Pseudomonas putidaGram-negative6CytoplasmicLargeAbsent
Bacillus subtilisGram-positive5ExtracellularShortPresent (cleavable)
Synechocystis sp.Cyanobacterium6CytoplasmicMediumAbsent
Silicibacter sp.*Alpha-proteobacteria6CytoplasmicMedium-LargeAbsent

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.