Recombinant Silicibacter sp. Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate them when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; TM1040_2821; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Ruegeria sp. (strain TM1040) (Silicibacter sp.)
Target Names
uppP
Target Protein Sequence
MPLLQLILVALIQGVTEFLPVSSSGHLILLPRLTGLEDQGQAIDVAVHVGTLAAVVLFFW RDVRAGLIGLPRALIGRLDTKGARLALGLIVATIPTVIFGTFLYFTGLSESLRSVAVIGW TMLVFGVVLYIADQRGPIDKSASDWGVRDAVIMGLWQMLALIPGTSRSGITITGARSLGY NREDGARIAMLMSIPTIIASGVLLGTEVALDADVDLMRDMGIAALLAMASALAALALMMR LLRSVSFTPYVIYRVALGMVLLFIAYG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the conserved structural motifs in UppP enzymes across bacterial species?

Two primary conserved structural motifs are critical for UppP function:

  • The (E/Q)XXXE motif - This motif is involved in binding the pyrophosphate moiety of UPP through interaction with a magnesium ion .

  • The PGXSRSXXT motif - This functions as a structural P-loop, with the arginine residue (R174 in E. coli) establishing hydrogen bonds with the OH group of the pyrophosphate moiety .

Additionally, a conserved histidine residue (His-30 in E. coli) has been identified in close spatial proximity to the pyrophosphate moiety in structural models . Site-directed mutagenesis studies have confirmed the importance of these motifs, as:

  • E17A and E21A mutations within the (E/Q)XXXE motif decrease kcat values approximately 5-fold

  • The double mutation E17A/E21A completely eliminates enzyme activity

  • The R174A mutation in the PGXSRSXXT motif completely inactivates the enzyme

  • The H30A mutation severely impairs enzyme activity

What experimental methods are recommended for measuring UppP activity in vitro?

For accurate measurement of UppP activity in vitro, the following methodology is recommended:

Phosphate Release Assay Protocol:

  • Prepare reaction mixture containing:

    • 50 mM Hepes (pH 7.0)

    • 150 mM NaCl

    • 10 mM MgCl₂

    • 0.02% DDM (dodecyl maltoside)

    • 35 μM Fpp (farnesyl pyrophosphate, as substrate analog)

    • 20 nM purified UppP

  • Incubate the reaction at 37°C

  • Quench by adding 30 μl of Malachite Green reagent

  • Measure released phosphate at 650 nm spectrophotometrically

  • Quantify based on a phosphate standard curve

For kinetic parameter determination:

  • Use 0.3-57 μM Fpp substrate concentration range

  • Use 20-40 nM UppP enzyme concentration

  • Fit initial velocity data to Michaelis-Menten equation using appropriate software

The effect of pH can be determined by assaying at various pH values: pH 5-6 (sodium acetate), pH 6.5-8 (Hepes), and pH 9 (Tris-HCl) .

How does UppP expression affect bacterial susceptibility to antibiotics?

UppP expression levels directly impact bacterial susceptibility to antibiotics targeting the lipid II cycle, particularly bacitracin. Bacitracin forms a complex with UPP, thereby preventing its dephosphorylation and depleting the UP pool, which ultimately leads to cell wall synthesis arrest . Research findings demonstrate:

  • Wild-type B. subtilis cells exhibit high resistance to bacitracin (MIC >256 μg/ml)

  • Deletion of uppP alone has no measurable effect on bacitracin MIC

  • Deletion of bcrC (another UPP phosphatase) reduces the MIC to approximately 120 μg/ml

  • UPP phosphatase-limited mutants show severely reduced resistance to bacitracin, with the phosphatase double mutant showing the greatest sensitivity

This demonstrates that while UppP contributes to bacitracin resistance, BcrC appears to play the primary role in this specific resistance mechanism, likely by competing with bacitracin for UPP binding .

What expression systems are most effective for producing recombinant UppP?

Based on research methodologies for membrane proteins like UppP, the following expression system has proven effective:

E. coli Expression System:

  • Host strain: E. coli BL21(DE3)

  • Vector design: Include fusion tags for purification and detection (6×His tag)

  • Induction: IPTG-inducible promoter system

  • Purification: Immobilized metal affinity chromatography (IMAC) using a Ni-NTA column

Key considerations for optimizing expression:

  • Include solubilization agents (detergents like DDM) for membrane protein extraction

  • Optimize buffer conditions with proper pH, salt concentration, and stabilizing agents

  • Include glycerol (50%) for storage stability

  • Store at -20°C for short-term or -80°C for extended storage

  • Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week

For advanced structural studies, bacteriorhodopsin has been used successfully as a fusion tag at the N-terminus of UppP to enhance expression and stability .

What is the relationship between UppP and BcrC in bacterial lipid II cycle regulation?

UppP and BcrC form a synthetic lethal gene pair in B. subtilis, meaning that while deletion of either gene individually is viable, simultaneous deletion of both genes is lethal . This relationship reveals several important aspects of lipid II cycle regulation:

  • Functional redundancy: Both UppP and BcrC catalyze the dephosphorylation of UPP to UP, providing redundancy in this critical step of peptidoglycan synthesis .

  • Differential regulation: BcrC expression is induced by cell envelope stress, particularly in response to bacitracin exposure, while UppP appears to be constitutively expressed .

  • Different cellular roles:

    • UppP plays a more prominent role in sporulation

    • BcrC is more directly involved in bacitracin resistance

  • Differential impacts when limited:

    • ΔbcrC mutants grow poorly in high-Mg²⁺ conditions

    • ΔuppP mutants show reduced sporulation efficiency

    • Double depletion mutants show severe morphological defects and growth impairment

This relationship demonstrates a sophisticated regulatory system ensuring the continuous supply of UP for cell wall synthesis, with each phosphatase potentially optimized for different growth conditions or developmental stages.

How do mutations in UppP affect bacterial cell morphology and sporulation?

Mutations affecting UppP function have profound effects on bacterial cell morphology and developmental processes, particularly sporulation. Research findings demonstrate:

Effects on general cell morphology:

  • Limited UppP levels (without compensating BcrC) lead to abnormal elongated cell morphology

  • Double depletion of UppP and BcrC results in severely compromised cell shape during fast growth

Effects on sporulation in B. subtilis:

  • Wild-type cells show approximately 30% sporulation efficiency after 24 hours

  • Mutants lacking native uppP but maintaining bcrC show drastically reduced sporulation (2-7%)

  • This sporulation deficiency remains even after 48 hours (2-5% compared to >30% in wild type)

  • ΔuppP mutants produce phase-gray spores instead of phase-bright spores, indicating defects in spore cortex or germ cell wall formation

Quantitative impact on sporulation:

  • Heat-resistant spore formation in ΔuppP mutants is only 0.04% of wild-type levels

  • This sporulation defect occurs even when BcrC is present, indicating UppP's specific role in sporulation

These observations indicate that UppP is the primary UPP phosphatase responsible for the lipid II cycle during sporulation, a specialized developmental process requiring precise cell wall remodeling.

How can CRISPR-based approaches enhance the study of UppP function?

CRISPR-based approaches offer powerful tools for studying UppP function, particularly given its essential nature when BcrC is absent. The search results indicate several specific applications:

  • CRISPRi knockdown systems:

    • Allow tunable repression of uppP expression

    • Enable study of partial loss-of-function phenotypes

    • Permit investigation of synthetic lethal interactions with bcrC

  • Advantages over traditional knockout methods:

    • Previous studies using pMUTIN-based gene disruptions reportedly generated misleading results due to residual gene function

    • Complete allelic replacement using double homologous recombination provides more definitive results

    • CRISPRi offers temporal control over gene repression

  • Applications for drug discovery:

    • CRISPRi systems targeting UppP have been used to identify potential inhibitors

    • This approach allows identification of compounds that might target the lipid II cycle differently than existing antibiotics

An optimized CRISPRi system has successfully demonstrated the functional redundancy of UppP and BcrC, confirming they are required for the conversion of UPP to UP in peptidoglycan and wall teichoic acid synthesis .

What is the relationship between UppP function and cell envelope stress response?

UppP function is intricately connected to bacterial cell envelope stress response (CESR) pathways, though in unexpected ways. Research findings reveal:

  • Despite UppP's critical role in cell wall synthesis, limitation of UppP levels does not trigger the classical CESR as measured by PliaI induction .

  • Instead, UppP limitation is perceived by the broader ECF-dependent signaling network, particularly affecting σ^M-dependent responses .

  • PbcrC promoter activity is significantly increased upon bacitracin addition (p = 0.021, 2-way ANOVA), while PuppP activity remains relatively constant .

  • The deletion of dgkA (encoding undecaprenol kinase) in a ΔbcrC background results in approximately 10-fold elevation of PsigM activity, indicating stress response activation through alternative pathways .

  • Bacitracin resistance is severely compromised in UppP-limited mutants, which can be partially restored by induction of ectopically integrated UPP phosphatase genes .

These findings suggest that bacterial cells have evolved sophisticated regulatory networks to monitor and respond to perturbations in the lipid II cycle, with different stress response pathways activated depending on the specific nature of the disruption.

What methodological approaches can resolve conflicting research findings about UppP function?

The search results reveal instances of conflicting research findings regarding UppP function, particularly concerning the viability of uppP/bcrC double mutants. Methodological approaches to resolve such conflicts include:

  • Careful construction of deletion mutants:

    • Previous studies using pMUTIN-based gene disruptions (single homologous recombination) reportedly generated misleading results

    • Complete allelic replacement using double homologous recombination provides more definitive results

  • Use of conditional expression systems:

    • Xylose-inducible expression systems allow controlled depletion studies

    • Enable verification of synthetic lethal relationships by demonstrating rescue under inducing conditions

  • Validation through orthogonal protocols:

    • Literature searches for experimental results that might contradict predictions

    • Blinded analysis of newly characterized proteins

    • Examination of database annotation corrections

  • Addressing misannotation issues:

    • Acknowledging the high levels of misannotation in enzyme superfamilies (except in Swiss-Prot)

    • Using evidence codes to describe the evidence supporting annotation assignments

    • Supporting manually curated databases to provide high-confidence annotation

  • Complementary structural approaches:

    • Computational modeling validated by molecular dynamics simulations

    • Site-directed mutagenesis of predicted catalytic residues

    • Biochemical assays to verify enzyme function

The application of these methodological approaches can help resolve conflicts in the research literature and provide more reliable insights into UppP function.

What are the current challenges in structural determination of UppP and potential solutions?

As an integral membrane protein, UppP presents several challenges for structural determination. Based on the research methodologies mentioned in the search results, the following challenges and solutions can be identified:

Challenges:

  • Membrane protein expression: Obtaining sufficient quantities of properly folded protein

  • Protein stability: Maintaining native conformation during purification

  • Crystallization: Difficulties in forming well-ordered crystals of membrane proteins

  • Functional validation: Ensuring purified protein retains catalytic activity

Potential solutions:

  • Expression strategies:

    • Fusion with bacteriorhodopsin as a tag at the N-terminus

    • Optimization of expression conditions in E. coli BL21(DE3)

    • Use of specialized promoters and host strains for membrane protein expression

  • Purification approaches:

    • Detergent screening for optimal solubilization

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA columns

    • Buffer optimization with stabilizing agents

  • Structural determination alternatives:

    • Computational modeling using Rosetta membrane ab initio modeling

    • Validation through molecular dynamics simulation analysis

    • Integration with site-directed mutagenesis data

  • Activity verification:

    • Malachite Green-based phosphate release assays

    • Kinetic parameter determination using Fpp as substrate analog

The structure-function study by Bickford and Nick successfully employed a combination of computational modeling, molecular dynamics, and mutagenesis to propose a UppP active site model, demonstrating that even without a crystal structure, significant insights into the enzyme's mechanism can be obtained.

How can knowledge of UppP function contribute to antibiotic development strategies?

Understanding UppP function provides valuable insights for antibiotic development strategies targeting bacterial cell wall synthesis:

  • UppP as a direct drug target:

    • UppP is essential when BcrC is absent, making it a potential target for combination therapy

    • The enzyme's active site, composed of (E/Q)XXXE and PGXSRSXXT motifs and a conserved histidine, offers specific binding sites for inhibitor design

  • Synergistic approaches:

    • Compounds inhibiting UppP could potentiate the activity of bacitracin

    • CRISPR-based approaches have identified UppP as a potential target for enhancing existing antibiotics

  • Cell envelope stress response modulation:

    • Understanding how UppP limitation affects stress response pathways may reveal vulnerabilities

    • Compounds targeting UppP might activate specific stress responses that sensitize bacteria to other antibiotics

  • Inhibition of lipid II cycle:

    • The lipid II cycle is one of the most frequently targeted processes for antibiotics

    • Compounds inhibiting UPP recycling may serve as effective antibiotics, similar to bacitracin

  • Species-specific targeting:

    • Variations in UppP structure and function across bacterial species could allow for more targeted therapies

    • Understanding the role of UppP in specific bacterial processes (such as sporulation) might enable selective targeting of specific bacterial states

The synthetic lethality of UppP and BcrC underscores the critical importance of UPP phosphatases in bacterial viability and suggests that targeting these enzymes could be a promising strategy for new antibiotic development.

Enzymatic characterization protocol for recombinant UppP

Materials required:

  • Purified recombinant UppP protein

  • Reaction buffer (50 mM Hepes, pH 7.0, 150 mM NaCl, 10 mM MgCl₂, 0.02% DDM)

  • Substrate: Farnesyl pyrophosphate (Fpp)

  • Malachite Green reagent

  • Phosphate standards for calibration

  • Spectrophotometer capable of measuring absorbance at 650 nm

Procedure:

  • Prepare a reaction mixture containing:

    • 50 mM Hepes (pH 7.0)

    • 150 mM NaCl

    • 10 mM MgCl₂

    • 0.02% DDM

    • 0.3-57 μM Fpp (for kinetic analysis)

    • 20-40 nM purified UppP

  • Incubate the reaction at 37°C for appropriate time intervals

  • Quench the reaction by adding 30 μl of Malachite Green reagent

  • Measure absorbance at 650 nm

  • Calculate released phosphate using a standard curve

  • For kinetic parameter determination, fit initial velocity data to the Michaelis-Menten equation

Table 1: Effect of site-directed mutations on UppP enzymatic activity

MutationRelative kcat (%)Km for Fpp (μM)kcat/Km (relative to WT)
Wild type1007-81.0
E17A~2032-35~0.05
E21A~207-8~0.2
E17A/E21A0-0
H30A<5-<0.05
R174A0-0

Data extrapolated from results described in search result

Protocol for UppP and BcrC depletion studies in B. subtilis

Materials required:

  • B. subtilis strains with relevant genotypes (wild type, ΔuppP, ΔbcrC, and conditional mutants)

  • Growth media with and without xylose for conditional expression

  • Microscope for morphological analysis

  • Bacitracin E-test strips for MIC determination

Procedure for growth and morphology analysis:

  • Prepare overnight cultures of strains in appropriate media

  • Dilute to OD600 of 0.05 in fresh media with or without xylose as needed

  • Grow at 37°C with shaking

  • Monitor growth by measuring OD600 at regular intervals

  • Take samples for phase contrast microscopy after 24 hours

  • Classify cells as normal, prespores, completed endospores, free spores, or small free spores

  • Calculate percentages of each cell type

Procedure for bacitracin sensitivity testing:

  • Prepare bacterial suspensions at standardized density

  • Spread on appropriate agar plates

  • Apply bacitracin E-test strips

  • Incubate at 37°C for 24 hours

  • Read MIC values where growth inhibition intersects the strip

Table 2: Sporulation efficiency and bacitracin resistance of UPP phosphatase mutants

Strain DescriptionSporulation Efficiency (%)Bacitracin MIC (μg/ml)
Wild type~30>256
ΔbcrC~30~120
ΔuppP2-7>256
PxylA-uppP (no xylose)<7~120
PxylA-uppP (with xylose)~30>256
ΔbcrC PxylA-uppP (no xylose)<5~10
ΔbcrC PxylA-uppP (with xylose)~30~120

Data compiled from results described in search result

Protocol for recombinant UppP production and purification

Materials required:

  • E. coli BL21(DE3) cells

  • Expression vector containing the uppP gene with appropriate tags

  • LB media and appropriate antibiotics

  • IPTG for induction

  • Buffers for cell lysis and protein purification

  • Ni-NTA resin for affinity purification

  • Detergent (DDM) for membrane protein solubilization

Procedure:

  • Transform E. coli BL21(DE3) cells with the expression vector

  • Select transformants on appropriate antibiotic-containing media

  • Inoculate a single colony into starter culture

  • Scale up to larger culture volume and grow to mid-log phase

  • Induce protein expression with IPTG

  • Harvest cells by centrifugation

  • Resuspend cell pellet in lysis buffer containing protease inhibitors

  • Disrupt cells by sonication or other methods

  • Solubilize membrane fraction with 0.02% DDM

  • Perform IMAC purification using Ni-NTA resin

  • Elute purified protein and check purity by SDS-PAGE

  • Store in 50% glycerol at -20°C for short-term or -80°C for long-term storage

Table 3: Optimal conditions for recombinant UppP expression and purification

ParameterOptimal ConditionNotes
Expression hostE. coli BL21(DE3)Standard strain for protein expression
Induction0.5-1.0 mM IPTGOptimize for each construct
Expression temperature16-25°CLower temperatures may improve folding
Expression time16-20 hoursFor overnight expression
Lysis bufferTris-based with protease inhibitorspH 7.5-8.0 typically used
Solubilization detergent0.02% DDMCritical for membrane protein extraction
Purification methodIMAC (Ni-NTA)Enabled by His-tag
Storage bufferTris-based with 50% glycerolMaintains stability during freezing
Storage temperature-20°C to -80°CAvoid repeated freeze-thaw cycles

Data compiled from methodologies described in search results

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.