Recombinant Simulium vittatum Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Simulium vittatum (Striped black fly)
Target Names
COII
Target Protein Sequence
MATWSNLGLQDSASPLMEQLNFFHDHTLLILIMITILVGYLMLMLFFNKFTNRFLLHGQT IEIIWTILPAIVLMFIALPSLRILYLLDEINSPAITLKTIGHQWYWSYEYSDFMNLEFDS YMVPTNELETNGFRLLDVDNRIVLPMNTQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFLMNRPGLFFGQCSEICGANHSFMPIVLESSPTNYFIKWITAMNSN
Uniprot No.

Target Background

Function

Recombinant Simulium vittatum Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation by facilitating the transfer of electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, powering transmembrane transport and ATP synthesis. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). COII plays a critical role in CIV, catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC, comprising heme A3 and copper B, CuB) in subunit 1. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Simulium vittatum Cytochrome c oxidase subunit 2 (COII) and what is its biological significance?

Cytochrome c oxidase subunit 2 is a critical component of the mitochondrial electron transport chain that functions in cellular respiration. In S. vittatum, COII is encoded by the mitochondrial genome and comprises 229 amino acids in its full-length form . This protein serves as an essential subunit of the cytochrome c oxidase (COX) complex, which catalyzes the terminal step in the electron transport chain, transferring electrons from cytochrome c to molecular oxygen.

The biological significance of COII extends beyond basic cellular metabolism. In blood-feeding insects like S. vittatum, proper mitochondrial function is crucial for energy-intensive processes such as flight, blood meal digestion, and reproduction. Alterations in COX activity can significantly impact the insect's fitness and potentially its vector competence. Studies measuring COX activity in microsomal preparations have established standardized protocols using commercial assay kits to quantify enzyme function in black fly tissues .

How does COII differ between Simulium species and what evolutionary insights can be gained?

The genus Simulium includes multiple species with varying vector competencies and geographical distributions. While specific COII sequence comparisons across all Simulium species are not comprehensively documented in the available literature, genomic studies reveal important evolutionary patterns.

The Simulium Genomics Project has targeted multiple Simulium species for genome sequencing, including S. vittatum, S. sirbanum, S. damnosum, and S. ochraceum, among others . These studies indicate conservation of chromosomal synteny between species, with no inter-chromosome arm rearrangements within selected groups, though intra-arm inversions do occur . This genomic conservation suggests that mitochondrial genes like COII may show evolutionary patterns that align with the cytogenomic relationships already established among black fly populations.

S. vittatum is particularly valuable as a model organism since it is the only Simulium species to have been successfully colonized in laboratory settings, with a colony maintained continuously for approximately 30 years . This provides a stable genetic background for comparative studies of mitochondrial proteins like COII across field-collected species.

What is known about the protein structure and functional domains of S. vittatum COII?

The commercially available recombinant S. vittatum COII protein consists of 229 amino acids (residues 1-229) and includes an N-terminal histidine tag to facilitate purification . While the search results do not provide the specific three-dimensional structure of S. vittatum COII, functional studies of cytochrome c oxidase from various organisms indicate that subunit II contains copper-binding sites critical for electron transfer.

The full-length protein is expressed in E. coli expression systems, suggesting that despite being a mitochondrial membrane protein, COII can be successfully produced in prokaryotic systems with appropriate modifications . This recombinant form provides researchers with a valuable tool for structural studies, antibody production, and functional characterization.

How can researchers use recombinant COII to investigate mitochondrial dysfunction in black flies?

Mitochondrial dysfunction has been implicated in various neurodegenerative disorders and can significantly impact organismal fitness. Researchers can use recombinant S. vittatum COII as a tool to investigate the molecular mechanisms underlying mitochondrial function in black flies and other insects.

Experimental approaches include:

What role might COII play in vector competence and the transmission of onchocerciasis?

Vector competence—the ability of a blood-feeding insect to acquire, maintain, and transmit pathogens—varies significantly among Simulium species. While direct evidence linking COII specifically to vector competence is not provided in the search results, several interconnected factors suggest potential relevance:

  • Energy requirements for vector activities: The COX complex is central to ATP production, which fuels the energy-intensive processes involved in host-seeking, blood-feeding, and pathogen maintenance. Variations in COII efficiency could therefore influence these vector behaviors.

  • Species-specific vector capacity: The Simulium Genomics Project categorizes species based on their vector status, ranging from non-vectors (S. vittatum) to major vectors of onchocerciasis (S. sirbanum and S. damnosum s.s.) . Comparing COII sequences and activity levels across these species could reveal correlations with vector status.

  • Population structure studies: As a mitochondrial gene, COII can serve as a genetic marker for population studies. The proposed resequencing of 50 individuals from key vector species (S. damnosum s.s. and S. sirbanum) aims to identify molecular markers for delineating endemic onchocerciasis foci, which could include mitochondrial markers .

How can COII genetics inform black fly population dynamics and migration patterns?

The Simulium Genomics Project emphasizes the need for population-level genetic markers to refine estimates of effective vector population sizes, particularly for long-distance migrating species like S. damnosum s.s. and S. sirbanum . As a mitochondrial gene, COII offers several advantages for population studies:

  • Maternal inheritance pattern: Mitochondrial genes are maternally inherited, allowing researchers to track maternal lineages across geographical regions.

  • Higher mutation rate: Compared to nuclear genes, mitochondrial genes typically evolve more rapidly, making them useful for distinguishing between recently diverged populations.

  • Application to field samples: DNA extraction methods established for black flies (e.g., Brockhouse et al., 1993) can be applied to field-collected samples for COII sequence analysis .

The unique S. ochraceum population of the Galapagos Islands represents a case study where COII genetics could provide insights into recent colonization events or rapid population expansion, potentially informing predictions about human health impacts in newly colonized regions .

What expression systems are optimal for producing functional recombinant COII?

The commercially available recombinant S. vittatum COII is produced in E. coli expression systems with an N-terminal histidine tag . While prokaryotic expression is evidently feasible, researchers should consider several factors when selecting an expression system:

  • Codon optimization: Adapting the COII coding sequence to match codon usage preferences of the expression host can improve expression efficiency.

  • Post-translational modifications: If studying functional aspects requiring specific modifications, eukaryotic expression systems may be preferable despite their lower yield compared to E. coli.

  • Solubility considerations: As a mitochondrial membrane protein component, COII may present solubility challenges. Expression as a fusion protein with solubility-enhancing tags (beyond the purification-focused His tag) might improve yields of properly folded protein.

  • Scale-up potential: For larger-scale protein production needed for structural studies, E. coli remains advantageous for cost and simplicity reasons.

What protocols are recommended for measuring COII enzymatic activity?

Based on established methods for measuring cytochrome c oxidase activity in Simulium and related insects, researchers should consider the following protocol elements:

  • Sample preparation:

    • Grind 30 adult flies in 2 ml extraction buffer (10 mM HEPES pH 7.5, 200 mM mannitol, 70 mM sucrose, 1 mM EGTA, protease inhibitors)

    • Use a motorized Potter-Elvehjem tissue grinder operating at 200 rpm, applying five strokes

    • Centrifuge homogenates at 600 × g for 5 min at 4°C

    • Collect supernatant and centrifuge at 14,000 rpm for 20 min to obtain microsomal pellets

    • Resuspend pellets in 200 μl buffer (10 mM HEPES pH 7.5, 250 mM sucrose, 1 mM ATP, 80 μM ADP, 5 mM sodium succinate, 2 mM potassium phosphate, 1 mM DTT)

  • Protein quantification:

    • Determine protein concentrations using a bicinchoninic acid (BCA) protein assay kit

  • Activity measurement:

    • Use commercial COX assay kit (CYTOC-OX1, Sigma-Aldrich) for standardized measurements

    • Run parallel assays for citrate synthase activity as a control for mitochondrial content

  • Data normalization:

    • Express COX activity relative to total protein content

    • Calculate the ratio of COX activity to citrate synthase activity to account for differences in mitochondrial content between samples

How can researchers integrate COII studies with broader genomic and transcriptomic data?

The Simulium Genomics Project has generated extensive genomic resources for black fly research, including a normalized transcriptome for S. vittatum representing all life stages . Researchers studying COII can leverage these resources through:

  • Comparative expression analysis:

    • The S. vittatum transcriptome consists of 16,384 contigs and 61,333 singletons

    • Expression patterns of COII across developmental stages can be extracted from this dataset

    • The consortium plans to make the database publicly available through InsectaCentral.org

  • Integration with cytogenomic maps:

    • The black fly research community has produced comprehensive cytogenomic analyses and chromosome synteny maps

    • Mapping COII genetic variations onto these physical maps can provide evolutionary context

    • The Brockhouse laboratory is working on BAC-FISH to generate a physical map that could include COII location

  • Multi-species comparisons:

    • The proposed sequencing of 11 Simulium species with different vector competencies offers opportunities for comparative analysis of COII across species

    • Particularly valuable comparisons include non-vector species (S. vittatum) versus major vectors (S. damnosum s.s., S. sirbanum)

What challenges exist in functional characterization of recombinant COII?

Researchers working with recombinant COII should anticipate several technical challenges:

  • Maintaining native conformation:

    • As part of a multi-subunit complex, isolated COII may not maintain its native conformation

    • Functional studies may require co-expression with interacting subunits

  • Enzymatic activity reconstitution:

    • The COX complex requires multiple subunits for activity

    • Researchers may need to combine recombinant COII with other purified or native components to reconstitute activity

  • Lipid environment requirements:

    • As a membrane protein complex component, COII function may depend on specific lipid environments

    • Reconstitution into liposomes or nanodiscs might be necessary for functional studies

  • Species-specific interactions:

    • When studying interactions between COII and other proteins, researchers should consider species compatibility

    • Heterologous systems may not reproduce all relevant interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.