Recombinant Simulium vittatum NADH-ubiquinone oxidoreductase chain 4 (ND4)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

Core Characteristics

ParameterValue/DetailSource
Protein LengthFull-length (1–79 amino acids)
Molecular Weight~8.6 kDa (calculated)
Amino Acid SequenceSVVAHMGIVLSGLMTLTMWGISGSYTLMIAHGLCSSGLFCLANISYERMGSRSLLINKGL LNFMPSLSLWWFLLCSSNM
TagN-terminal His-tag
Subcellular LocalizationMitochondrial membrane (multi-pass)

1.2 Functional Role
ND4 is integral to Complex I, catalyzing the oxidation of NADH to NAD⁺ and transferring electrons to ubiquinone. This reaction contributes to proton translocation across the mitochondrial membrane, driving ATP synthesis .

Production and Purification

2.1 Expression System
The recombinant ND4 is expressed in E. coli using optimized vectors to ensure high yield and proper folding. Key production parameters include:

ParameterDetailSource
Host OrganismE. coli
Purity>90% (SDS-PAGE validated)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0

Post-Production Handling

  • Reconstitution: Dissolve in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Storage: -20°C/-80°C; avoid repeated freeze-thaw cycles .

Research Applications

Experimental Uses

ApplicationMethod/OutcomeSource
SDS-PAGE AnalysisPurity validation (>90% band intensity)
ELISA DevelopmentAntigen for antibody production
Functional AssaysStudying electron transport chain dynamics

3.2 Comparative Analysis
The Simulium vittatum ND4 shares structural homology with human ND4 (UniProt ID: P03905), though differences in sequence and membrane topology exist .

Key Research Findings

Stability and Handling

  • Trehalose in the storage buffer prevents protein aggregation during lyophilization .

  • Working aliquots must be stored at 4°C for ≤1 week to maintain activity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-79
Protein Length
full length protein
Species
Simulium vittatum (Striped black fly)
Target Names
ND4
Target Protein Sequence
SVVAHMGIVLSGLMTLTMWGISGSYTLMIAHGLCSSGLFCLANISYERMGSRSLLINKGL LNFMPSLSLWWFLLCSSNM
Uniprot No.

Target Background

Function

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly required for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.