Recombinant Sinapis alba Chlorophyll a-b binding protein 1, chloroplastic (CAB1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CAB1; Chlorophyll a-b binding protein 1, chloroplastic; LHCII type I CAB-1; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-266
Protein Length
Full Length of Mature Protein
Species
Sinapis alba (White mustard) (Brassica hirta)
Target Names
CAB1
Target Protein Sequence
RKTVKPTGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNR ELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQ SILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKEI KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) acts as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How can recombinant Sinapis alba CAB1 protein be produced and purified?

Recombinant Sinapis alba CAB1 protein can be effectively produced using E. coli expression systems. The methodological approach involves:

  • Gene cloning: The mature coding sequence (amino acids 36-266) is cloned into an expression vector with an N-terminal His-tag.

  • Expression conditions: Transform the construct into E. coli and induce expression under optimized conditions.

  • Purification: Use immobilized metal affinity chromatography (IMAC) to purify the His-tagged protein.

  • Quality control: Verify purity using SDS-PAGE (>90% purity is achievable).

  • Storage: Lyophilize the purified protein and store at -20°C/-80°C in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

For reconstitution, dissolve the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add 5-50% glycerol for long-term storage. Avoid repeated freeze-thaw cycles for maximum stability .

What experimental systems are suitable for studying Sinapis alba CAB1 function?

Several experimental systems are appropriate for studying CAB1 function:

In planta systems:

  • Transgenic Sinapis alba plants with modified CAB1 expression can be generated through Agrobacterium-mediated transformation of stem explants, with regeneration of fertile plants within 14-16 weeks .

  • Integration and expression of transgenes can be confirmed via histochemical assays and Southern-DNA hybridization .

Comparative systems:

  • Arabidopsis thaliana mutants lacking specific light-harvesting proteins (e.g., Lhcb1 or Lhcb2) provide models for functional comparison with Sinapis alba CAB1 .

  • Cross-species complementation experiments can determine functional conservation between Sinapis alba CAB1 and homologs in other plant species.

In vitro systems:

  • Reconstitution of recombinant CAB1 with chlorophyll and lipids to form artificial light-harvesting complexes for biophysical analysis.

How does CAB1 expression in Sinapis alba vary across different tissues and developmental stages?

Transcriptome analysis of Sinapis alba reveals tissue-specific expression patterns of photosynthetic proteins including CAB1:

TissueCAB1 Expression LevelAssociated Pathways
LeavesHighPhotosynthesis, carbon fixation
StemsModerateSugar metabolism, plant hormone signal transduction
RootsLow/NegligibleNot significantly associated with photosynthetic pathways

In leaves, CAB1 and other photosynthesis-related genes show predominant expression, consistent with their role in light harvesting. The leaf transcriptome is enriched in photosynthesis and carbon fixation-related pathways . This tissue-specific expression is likely regulated through developmental cues and environmental signals, particularly light intensity and photoperiod.

Unlike the aliphatic glucosinolate synthesis genes that show root-predominant expression in Sinapis alba, photosynthetic genes including CAB1 follow the expected pattern of highest expression in photosynthetically active tissues .

What methods can be used to study the circadian regulation of CAB1 in Sinapis alba?

CAB genes, including CAB1, are among the most thoroughly characterized clock-regulated genes in plants . To study circadian regulation of CAB1 in Sinapis alba, researchers can employ:

  • Time-course gene expression analysis:

    • Collect tissue samples at regular intervals over 48-72 hours under constant light conditions

    • Extract RNA and quantify CAB1 transcript levels using qRT-PCR

    • Plot expression levels against time to identify oscillation patterns

  • Luciferase reporter assays:

    • Create transgenic Sinapis alba plants with the CAB1 promoter driving luciferase expression

    • Monitor bioluminescence in real-time under various light conditions

    • Analyze phase, amplitude, and period of expression cycles

  • Promoter analysis:

    • Identify cis-regulatory elements in the CAB1 promoter that mediate clock control

    • Perform chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the CAB1 promoter

    • Conduct promoter deletion studies to map essential regulatory regions

  • Entrainment experiments:

    • Subject plants to different light/dark cycles and measure CAB1 expression

    • Test the effects of temperature cycles on expression patterns

    • Investigate phase resetting in response to environmental stimuli

These approaches can reveal how the circadian clock coordinates CAB1 expression with daily environmental cycles to optimize photosynthetic efficiency .

How can seed priming techniques affect CAB1 expression and photosynthetic efficiency in Sinapis alba?

Recent studies on Sinapis alba seed priming show significant effects on growth parameters and photosynthetic efficiency, which likely involve CAB1 expression:

Priming TreatmentEffect on Chlorophyll ContentEffect on Leaf AreaPotential Impact on CAB1
Control (T1)BaselineBaselineBaseline expression
Distilled water (T2)Moderate increaseModerate increaseModerate upregulation
NaCl 0.5% (T3)Moderate increaseModerate increaseModerate upregulation
KNO₃ 0.5% (T4)Significant increaseSignificant increaseSignificant upregulation
CaCl₂ 0.5% (T5)Moderate increaseModerate increaseModerate upregulation
Moringa leaf extract (T6)Significant increaseSignificant increaseSignificant upregulation

Seed priming with KNO₃ (0.5%) and Moringa leaf extract showed the most significant improvements in photosynthetic parameters . To investigate the molecular basis:

  • Expression analysis: Compare CAB1 transcript levels in seedlings from differently primed seeds using qRT-PCR.

  • Protein quantification: Use western blotting with CAB1-specific antibodies to determine if increased chlorophyll content correlates with increased CAB1 protein levels.

  • Photosynthetic measurements: Correlate CAB1 expression with:

    • Photosystem II efficiency (Fv/Fm)

    • Net photosynthetic rate

    • Chlorophyll fluorescence parameters

  • Chlorophyll-protein complex analysis: Isolate thylakoid membranes and characterize chlorophyll-protein complexes using non-denaturing gel electrophoresis.

These methods can establish whether enhanced photosynthetic efficiency from seed priming involves upregulation of CAB1 and other light-harvesting proteins .

How do the functional roles of Sinapis alba CAB1 compare to Lhcb1 and Lhcb2 in Arabidopsis thaliana during state transitions?

State transitions represent a fundamental regulatory mechanism for balancing excitation energy between photosystems I and II. Research on Arabidopsis has revealed distinct but complementary roles for Lhcb1 and Lhcb2 in this process:

ProteinRole in State TransitionsPhenotype When Absent
Lhcb1Provides structural basis for LHCII trimersReduced LHCII trimer formation, altered thylakoid membrane structure, impaired state transitions
Lhcb2Critical for phosphorylation-dependent mobilityNormal LHCII trimer formation but inability to perform state transitions

For Sinapis alba CAB1, comparative functional studies could include:

  • Complementation experiments: Express Sinapis alba CAB1 in Arabidopsis lhcb1 or lhcb2 mutants to determine functional equivalence.

  • Phosphorylation analysis: Compare phosphorylation patterns of Sinapis alba CAB1 with Arabidopsis Lhcb1/Lhcb2 using:

    • Phosphoproteomic analysis (LC-MS/MS)

    • Phos-tag SDS-PAGE

    • Site-directed mutagenesis of potential phosphorylation sites

  • Ultrastructural studies: Examine thylakoid membrane reorganization during state transitions in:

    • Wild-type Sinapis alba

    • Plants with modified CAB1 expression

    • Plants expressing modified versions of CAB1 (e.g., phosphorylation site mutants)

  • Comparative spectroscopy: Characterize energy transfer efficiency in reconstituted systems containing:

    • Sinapis alba CAB1

    • Arabidopsis Lhcb1

    • Arabidopsis Lhcb2

These approaches would determine whether Sinapis alba CAB1 functions more like Lhcb1 (structural role) or Lhcb2 (phosphorylation-dependent mobility) in Arabidopsis, or has unique properties .

What are the experimental approaches to study the evolutionary conservation of CAB1 structure and function across Brassicaceae species?

Evolutionary analysis of CAB1 across Brassicaceae can provide insights into functional conservation and adaptation. Research approaches include:

  • Comparative genomics:

    • Analyze the recently assembled Sinapis alba draft genome (~459 Mbp) to identify the complete CAB gene family

    • Compare CAB1 gene structure, promoter elements, and synteny with Arabidopsis thaliana and other Brassicaceae

    • Identify selection signatures using dN/dS ratio analysis across lineages

  • Protein structure prediction and analysis:

    • Use AlphaFold or similar tools to predict 3D structures of CAB1 from multiple Brassicaceae species

    • Identify conserved domains and variable regions

    • Correlate structural conservation with functional constraints

  • Experimental validation:

    • Express CAB1 orthologs from different Brassicaceae in a heterologous system

    • Compare binding affinities for chlorophyll and carotenoids

    • Assess protein stability under various stress conditions

  • Phylogenetic dating:

    • Estimate the divergence times of CAB1 variants

    • Correlate with the divergence of bryophyte and spermatophyte lineages (>300 million years ago)

    • Identify key evolutionary events in the specialization of light-harvesting proteins

The detailed architecture of the extant seed plant light-harvesting antenna, including CAB1, dates back to a time after the divergence of bryophyte and spermatophyte lineages but before the split of angiosperm and gymnosperm lineages more than 300 million years ago .

How can recombinant Sinapis alba CAB1 be optimized for structural studies and biophysical characterization?

Structural and biophysical characterization of membrane proteins like CAB1 presents significant challenges. Advanced approaches include:

  • Protein engineering for crystallization:

    • Design truncated constructs removing flexible regions

    • Introduce surface mutations to enhance crystal contacts

    • Create fusion proteins with crystallization chaperones (e.g., T4 lysozyme)

    • Develop nanobodies or designed ankyrin repeat proteins (DARPins) as crystallization aids

  • Expression system optimization:

    • Compare protein yield and folding in multiple expression systems:

      • E. coli with specialized strains for membrane proteins

      • Insect cell expression systems

      • Cell-free expression systems with supplied lipids or detergents

  • Reconstitution approaches:

    • Optimize detergent screening for protein solubilization and stability

    • Develop protocols for incorporation into nanodiscs or liposomes

    • Create co-reconstitution systems with photosystem components

  • Advanced biophysical methods:

    • Cryo-electron microscopy for structure determination

    • Solid-state NMR for dynamics studies

    • Time-resolved spectroscopy for energy transfer kinetics

    • Single-molecule fluorescence for conformational dynamics

  • Pigment reconstitution strategies:

    • Develop protocols for in vitro assembly of CAB1 with chlorophylls and carotenoids

    • Optimize pigment:protein ratios for functional complex formation

    • Characterize energy transfer pathways using ultrafast spectroscopy

These approaches would provide detailed insights into the structure-function relationships of Sinapis alba CAB1 and its role in light harvesting and energy transfer .

What methodologies can be used to investigate the role of CAB1 in abiotic stress tolerance in Sinapis alba?

Sinapis alba is known for phytoremediation applications and stress tolerance. Investigating CAB1's role in abiotic stress responses requires:

  • Stress-responsive expression analysis:

    • Monitor CAB1 transcript and protein levels under:

      • Heavy metal exposure

      • Drought stress

      • Temperature extremes

      • High light stress

    • Compare with known stress response markers

  • Genetic modification approaches:

    • Generate Sinapis alba lines with modified CAB1 expression using:

      • Agrobacterium-mediated transformation

      • CRISPR/Cas9 genome editing

    • Evaluate stress tolerance phenotypes

  • Protein interaction studies:

    • Identify CAB1 interaction partners under stress conditions using:

      • Co-immunoprecipitation

      • Yeast two-hybrid screening

      • Proximity labeling approaches (BioID, APEX)

    • Map interaction networks and their changes during stress

  • Thylakoid membrane dynamics:

    • Characterize changes in thylakoid ultrastructure during stress

    • Analyze lipid composition and protein mobility

    • Correlate membrane reorganization with photosynthetic efficiency

  • Integrative multi-omics approach:

    • Combine transcriptomics, proteomics, and metabolomics

    • Focus on photosynthetic complexes and energy metabolism

    • Identify key regulatory hubs connecting CAB1 to stress response pathways

Sinapis alba's transcriptome reveals tissue-specific expression patterns that may contribute to stress tolerance, including differential glutathione metabolism in roots and leaves, which could influence how photosynthetic machinery responds to oxidative stress .

What are the optimal conditions for maintaining recombinant Sinapis alba CAB1 stability for long-term experimental use?

For optimal stability of recombinant Sinapis alba CAB1:

Storage ConditionRecommendationRationale
Short-term storage4°C for up to one weekMinimizes protein degradation while maintaining accessibility
Long-term storage-20°C/-80°C in aliquotsPrevents degradation and avoids repeated freeze-thaw cycles
Buffer compositionTris/PBS-based buffer, pH 8.0 with 6% trehaloseTrehalose acts as a cryoprotectant
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLEnsures proper solubilization
Additives5-50% glycerol (final concentration)Prevents protein aggregation during freeze-thaw

Additional stability considerations:

  • Avoid repeated freeze-thaw cycles - Each cycle significantly reduces protein activity

  • Centrifuge vials briefly before opening to bring contents to the bottom

  • Aliquot reconstituted protein to minimize freeze-thaw cycles

  • Consider adding reducing agents (e.g., DTT or β-mercaptoethanol) if the protein contains critical cysteine residues

  • Monitor protein integrity periodically using SDS-PAGE

These conditions ensure maximum stability while preserving the functional integrity of the recombinant protein for experimental applications.

How can researchers troubleshoot issues with expression and purification of recombinant Sinapis alba CAB1?

Common challenges and troubleshooting approaches for recombinant CAB1:

IssuePossible CausesTroubleshooting Approaches
Low expression yieldProtein toxicity to host cells- Use tightly regulated induction systems
- Try lower induction temperatures (16-20°C)
- Test different E. coli strains (BL21, Rosetta, C41/C43)
Protein insolubilityMembrane protein properties- Optimize solubilization with different detergents
- Test fusion tags (MBP, SUMO) to enhance solubility
- Consider cell-free expression systems
Poor purificationInaccessible His-tag- Try different tag positions (N- vs C-terminal)
- Include denaturants during lysis and refolding
- Optimize imidazole concentration in binding/wash buffers
Protein degradationProtease activity- Add protease inhibitors during extraction
- Reduce processing time and temperature
- Try different E. coli strains with reduced protease activity
Lack of functionalityImproper folding- Include chaperones during expression
- Optimize refolding conditions if extraction under denaturing conditions
- Add cofactors during purification

Validation methods:

  • Western blotting with anti-His antibodies to confirm expression

  • Mass spectrometry to verify protein identity

  • Circular dichroism to assess secondary structure

  • Size exclusion chromatography to evaluate oligomeric state

  • Pigment binding assays to confirm functionality

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.