Recombinant Sinapis alba Cytochrome P450 79B1 (CYP79B1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and confirmed in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your requirements.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize fulfilling your request during the production process.
Synonyms
CYP79B1; Cytochrome P450 79B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-542
Protein Length
full length protein
Species
Sinapis alba (White mustard) (Brassica hirta)
Target Names
CYP79B1
Target Protein Sequence
MNTFTSNSSDLTSTTKQTLSFSNMYLLTTLQAFVAITLVMLLKKVLVNDTNKKKLSLPPG PTGWPIIGMVPTMLKSRPVFRWLHSIMKQLNTEIACVRLGSTHVITVTCPKIAREVLKQQ DALFASRPMTYAQNVLSNGYKTCVITPFGEQFKKMRKVVMTELVCPARHRWLHQKRAEEN DHLTAWVYNMVNNSDSVDFRFVTRHYCGNAIKKLMFGTRTFSQNTAPNGGPTAEDIEHME AMFEALGFTFSFCISDYLPILTGLDLNGHEKIMRDSSAIMDKYHDPIIDARIKMWREGKK TQIEDFLDIFISIKDEEGNPLLTADEIKPTIKELVMAAPDNPSNAVEWAMAEMVNKPEIL RKAMEEIDRVVGKERLVQESDIPKLNYVKAILREAFRLHPVAAFNLPHVALSDATVAGYH IPKGSQVLLSRYGLGRNPKVWADPLSFKPERHLNECSEVTLTENDLRFISFSTGKRGCAA PALGTALTTMLLARLLQGFTWKLPENETRVELMESSHDMFLAKPLVMVGELRLPEHLYPT VK
Uniprot No.

Target Background

Function
Recombinant *Sinapis alba* Cytochrome P450 79B1 (CYP79B1) catalyzes the conversion of tyrosine to para-hydrophenylacetaldoxime in the biosynthesis of para-hydroxybenzylglucosinolate.
Protein Families
Cytochrome P450 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is CYP79B1 and what is its primary function?

CYP79B1 is a cytochrome P450 enzyme from Sinapis alba (white mustard) that catalyzes the conversion of tryptophan to indole-3-acetaldoxime in the biosynthesis pathway of indole glucosinolates . This enzyme belongs to the CYP79B subfamily of cytochrome P450 enzymes, which appears to constitute a group of orthologous genes involved in indole glucosinolate biosynthesis across various plant species . The enzyme represents an important component in plant secondary metabolism, particularly in cruciferous plants like those in the Brassicaceae family, where glucosinolates serve as defense compounds against herbivores and pathogens.

How does CYP79B1 relate to other CYP79 family members?

CYP79B1 shares significant sequence homology with other members of the CYP79 family. It has 93% identity at the amino acid level to Arabidopsis thaliana CYP79B2 and 84% to CYP79B3 . It also shows 96% identity to CYP79B5 from Brassica napus (Accession No. AF453287) . Notably, CYP79B1 has 54% sequence identity and 73% similarity to sorghum CYP79A1 . These high levels of sequence conservation suggest functional similarity, though substrate specificities may vary. The CYP79 family as a whole is diverse, with different members specialized for converting various amino acids to their corresponding aldoximes in different glucosinolate biosynthetic pathways.

What are the kinetic properties of recombinant CYP79B1?

Recombinant CYP79B1 expressed in E. coli has been biochemically characterized with specific kinetic parameters. The enzyme demonstrates a Michaelis-Menten constant (Km) for tryptophan of 29±2 μM and a maximum velocity (Vmax) of 36.5±0.7 nmol h−1 (ml culture)−1 . These kinetic parameters indicate that CYP79B1 has a relatively high affinity for its tryptophan substrate. The enzyme activity measurements were conducted using spheroplasts of E. coli expressing CYP79B1, reconstituted with the Arabidopsis thaliana NADPH:cytochrome P450 reductase ATR1 heterologously expressed in E. coli . This reconstitution was necessary to obtain enzymatic activity, suggesting that the E. coli electron-donating system (flavodoxin/flavodoxin reductase) does not support CYP79B1 activity .

How can CYP79B1 be heterologously expressed in E. coli?

For heterologous expression of CYP79B1 in E. coli, researchers have used several expression constructs with varying results. Three different expression constructs have been documented: one expressing the native protein and two expressing proteins with different N-terminal modifications . The construct expressing the native protein yielded the highest enzymatic activity per liter of culture, making it the preferred choice for recombinant expression .

The expression protocol typically involves:

  • Cloning the CYP79B1 gene into an appropriate expression vector

  • Transforming the construct into a suitable E. coli strain

  • Inducing protein expression under optimized conditions

  • Creating spheroplasts of the E. coli cells expressing CYP79B1

  • Reconstituting the enzyme activity by co-expressing or adding NADPH:cytochrome P450 reductase (such as ATR1 from A. thaliana)

This approach is necessary because the endogenous E. coli electron transport proteins do not efficiently couple with CYP79B1, requiring supplementation with a compatible reductase partner.

What methods are available for analyzing CYP79B1 substrate specificity?

Analysis of CYP79B1 substrate specificity can be performed using several approaches, with transient expression systems in plants being particularly informative. One effective method involves Agrobacterium-mediated transient expression in Nicotiana benthamiana, where CYP79B1 is co-expressed with other enzymes of the glucosinolate biosynthetic pathway, followed by analysis of the resulting glucosinolate profile .

This approach has several advantages:

  • It allows for in vivo assessment of substrate specificity

  • It enables researchers to evaluate the enzyme in the context of a complete biosynthetic pathway

  • It can reveal unexpected substrate preferences that might not be apparent in in vitro assays

The methodology includes:

  • Cloning CYP79B1 into a plant expression vector (e.g., pCAMBIA330035Su) using appropriate cloning methods (e.g., USER cloning)

  • Co-transforming with other glucosinolate biosynthetic genes

  • Performing Agrobacterium-mediated transient expression in N. benthamiana leaves

  • Extracting and analyzing the produced glucosinolates using techniques such as LC-MS/MS

  • Comparing glucosinolate profiles to determine which amino acids are accepted as substrates

This approach has revealed that CYP79 enzyme substrate specificity can be influenced by the co-expressed pathway, providing insights into metabolic channeling in complex biosynthetic pathways.

How can homology models of CYP79B1 be generated and utilized?

Homology modeling of CYP79B1 can be conducted using experimentally determined structures of related cytochrome P450 enzymes as templates. While there is no specific crystal structure for CYP79B1 in the Protein Data Bank (PDB), several other CYP structures can serve as templates for modeling .

The process of generating a homology model for CYP79B1 typically involves:

  • Template selection from available CYP structures in PDB, such as:

    • CYP1A2 (PDB-ID: 2hi4)

    • CYP2A6 (PDB-IDs: 1z10, 1z11, etc.)

    • CYP3A4 (PDB-IDs: 1w0e, 1w0f, etc.)

  • Sequence alignment between CYP79B1 and the template structure(s)

  • Model building using specialized software packages

  • Refinement and validation of the model structure

  • Analysis of the active site and potential substrate binding regions

The resulting homology models can be used to:

  • Predict substrate binding modes and enzyme-substrate interactions

  • Understand the structural basis for substrate specificity

  • Guide site-directed mutagenesis experiments to alter substrate specificity or improve enzyme activity

  • Interpret experimental data on enzyme kinetics and inhibition

Such structural information can significantly enhance our understanding of CYP79B1 function and inform experimental design for further characterization.

How does CYP79B1 substrate specificity compare with other CYP79 family members?

CYP79 EnzymePrimary SubstratesMajor ProductsSource
CYP79B1TryptophanIndole-3-acetaldoximeSinapis alba
CYP79B2/B3TryptophanIndole-3-acetaldoximeArabidopsis thaliana
CYP79C1Phenylalanine, Leucine, Dihomoleucine, DihomomethionineBenzyl GLS, 2MP GLS, 4MP, 4MTBArabidopsis thaliana
CYP79C2Phenylalanine, Leucine, IsoleucineBenzyl GLS, 2MP GLS, 1MP GLSArabidopsis thaliana
CYP79F1Chain-elongated methionine derivativesAliphatic glucosinolatesArabidopsis thaliana
CYP79A2Phenylalanine, TyrosineBenzyl GLS, pOHBArabidopsis thaliana
CYP79D2Valine, Isoleucine, Leucine1ME, 1MP, 2MPManihot esculenta

Substrate specificity studies have revealed that the CYP79 enzymes can often accept multiple amino acids as substrates, although with varying efficiencies. The substrate preference can also be influenced by the co-expressed pathway genes, suggesting metabolic channeling effects in glucosinolate biosynthesis . For instance, when CYP79C1 and CYP79C2 were co-expressed with different core biosynthetic pathways in N. benthamiana, their apparent substrate preferences changed significantly .

Understanding these comparative specificities is crucial for metabolic engineering applications and for elucidating the evolutionary relationships between these enzymes.

What factors influence the coupling of CYP79B1 with electron donor systems?

CYP79B1, like other cytochrome P450 enzymes, requires an electron donor system to function. Research has demonstrated that CYP79B1 does not effectively couple with the endogenous E. coli electron transport proteins (flavodoxin/flavodoxin reductase) . Instead, reconstitution with heterologously expressed NADPH:cytochrome P450 reductase ATR1 from Arabidopsis thaliana is necessary to achieve enzymatic activity .

Several factors can influence this coupling:

Understanding these factors is essential for optimizing heterologous expression systems for functional studies of CYP79B1 and related enzymes. Researchers may need to co-express or add appropriate reductase partners when studying these enzymes in heterologous systems to ensure proper function.

How can genetic engineering be used to modify CYP79B1 substrate specificity?

Modifying the substrate specificity of CYP79B1 through genetic engineering represents an advanced research direction with significant potential applications. Based on current understanding of cytochrome P450 enzymes, several approaches can be considered:

  • Structure-guided mutagenesis: Using homology models of CYP79B1, researchers can identify amino acid residues in the active site that likely interact with the substrate. Targeted mutations of these residues may alter substrate binding and catalysis.

  • Domain swapping: Given the high sequence similarity between CYP79B1 and other CYP79 family members with different specificities (like CYP79B2, CYP79B3, and CYP79B5) , domain swapping between these enzymes could create chimeric proteins with novel substrate specificities.

  • Directed evolution: Random mutagenesis followed by screening for desired activities can be used to evolve CYP79B1 variants with altered substrate specificity.

  • Rational design based on substrate docking: Computational docking of alternative substrates can guide the design of mutations to accommodate these substrates.

  • Co-expression with different pathway components: As demonstrated with CYP79C1 and CYP79C2, the apparent substrate specificity of CYP79 enzymes can be influenced by co-expressed pathway components . Engineering the entire metabolic context could therefore alter the effective substrate range of CYP79B1.

These approaches could potentially expand the range of amino acids accepted by CYP79B1 or enhance its specificity for particular substrates, opening new possibilities for metabolic engineering of glucosinolate biosynthesis.

What are the implications of CYP79B1 polymorphisms for glucosinolate profiles in different plant species?

While specific information on CYP79B1 polymorphisms is not directly provided in the search results, research on cytochrome P450 enzymes generally indicates that polymorphisms can significantly impact enzyme function. Based on current understanding of CYP enzymes and glucosinolate biosynthesis, several implications can be inferred:

The SuperCYP database contains information on approximately 2000 SNPs and mutations in cytochrome P450 enzymes, ordered according to their effect on expression and/or activity . Although specific information on CYP79B1 polymorphisms is not provided, this resource suggests that polymorphisms in CYP enzymes generally can have significant functional consequences.

Understanding these polymorphisms could be valuable for breeding programs aimed at modifying glucosinolate profiles in crop plants for improved pest resistance or nutritional value.

How can metabolic engineering approaches utilizing CYP79B1 be optimized for glucosinolate production?

Optimizing metabolic engineering approaches that utilize CYP79B1 for glucosinolate production requires consideration of multiple factors:

  • Expression system selection: Different expression systems offer various advantages for CYP79B1 expression:

    • E. coli provides high yields but requires reconstitution with a compatible reductase

    • Plant-based systems like N. benthamiana offer a more native-like environment but may have lower expression levels

    • Yeast systems may represent a compromise between yield and eukaryotic processing capabilities

  • Pathway engineering considerations:

    • Co-expression with compatible reductase partners is essential for CYP79B1 activity

    • The complete glucosinolate biosynthetic pathway should be considered, as demonstrated by the influence of core pathway enzymes on CYP79 substrate specificity

    • The expression of APK2 (APS kinase) alongside core pathway genes can be critical for efficient regeneration of the PAPS cofactor needed in the final sulfotransferase step

  • Optimizing enzyme ratios:

    • The relative expression levels of CYP79B1 and other pathway enzymes can significantly influence the flux through the pathway

    • Balancing expression levels to avoid bottlenecks is essential for maximizing product yield

  • Substrate availability:

    • Ensuring sufficient supply of tryptophan is crucial for indole glucosinolate production

    • Engineering the upstream amino acid biosynthesis pathway may be necessary for optimal production

  • Product toxicity management:

    • Glucosinolates and their degradation products can be toxic to the production organism

    • Compartmentalization or export mechanisms may need to be engineered to prevent toxicity

This integrated approach to metabolic engineering, considering both the properties of CYP79B1 itself and the context of the complete biosynthetic pathway, offers the best prospects for successful glucosinolate production in heterologous systems.

What are the emerging trends in CYP79B1 research and applications?

Research on CYP79B1 and related cytochrome P450 enzymes continues to evolve, with several emerging trends:

  • Systems biology approaches: Investigating CYP79B1 in the context of the complete glucosinolate biosynthetic network, including metabolic channeling and protein-protein interactions, is providing deeper insights into the regulation of these pathways .

  • Structural biology advances: While no crystal structure of CYP79B1 is currently available, ongoing efforts to solve structures of related cytochrome P450 enzymes will likely improve our ability to model and understand CYP79B1 function at the molecular level.

  • Synthetic biology applications: The ability to express and manipulate CYP79B1 and other glucosinolate biosynthetic enzymes in heterologous systems opens possibilities for the production of bioactive glucosinolates and their derivatives for various applications .

  • Computational approaches: The integration of bioinformatics, molecular modeling, and simulation techniques is enhancing our understanding of CYP79B1 function and evolution.

  • Cross-disciplinary applications: Research on CYP79B1 and glucosinolate biosynthesis is finding applications in agricultural biotechnology, nutritional science, and medicinal chemistry.

These trends suggest a bright future for research on CYP79B1, with potential applications spanning multiple disciplines and addressing important challenges in agriculture, nutrition, and health.

What methodological advances are needed to resolve current challenges in CYP79B1 research?

Several methodological advances would help address current challenges in CYP79B1 research:

  • Structural determination: Obtaining a crystal structure or cryo-EM structure of CYP79B1 would greatly enhance our understanding of its function and substrate specificity.

  • Improved expression systems: Developing expression systems that better mimic the native environment of CYP79B1 while maintaining high yields would facilitate more accurate functional studies.

  • In situ activity assays: Methods to measure CYP79B1 activity in its native cellular context would provide insights into its regulation and interactions with other proteins.

  • High-throughput screening methods: Techniques for rapidly assessing the activity of CYP79B1 variants would accelerate protein engineering efforts.

  • Integration of computational and experimental approaches: Combining molecular modeling, simulation, and experimental validation would enhance our ability to predict and manipulate CYP79B1 function.

  • Standardized reporting of enzymatic parameters: Consistent methodologies and reporting of kinetic parameters would facilitate comparisons between studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.