Recombinant Sinapis alba Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Species: Sinapis alba (White mustard)
Expression System: Escherichia coli
Tag: N-terminal His tag
UniProt ID: P11848

Amino Acid Sequence:

The 343-residue sequence begins with:
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEA...

Functional Domains:

  • Photosystem II core: Binds plastoquinone (Q<sub>B</sub>) for electron transfer .

  • Transmembrane regions: Critical for integration into thylakoid membranes .

Post-Translational Modifications:

  • No modifications reported; expressed as a denatured, lyophilized powder .

Experimental Uses:

  • SDS-PAGE analysis: Primary application for purity validation .

  • Antigen production: Potential use in antibody generation (implied by ELISA-compatible formats) .

Comparative Studies:

A homolog in Prorocentrum micans (UniProt Q9TM72) shares 78% sequence identity but differs in key regions:

FeatureSinapis alba Q(B) ProteinProrocentrum micans Q(B) Protein
SpeciesPlant (White mustard)Dinoflagellate
Protein Length343 aa (2–344)343 aa (1–343)
Key ResiduesPhe-255, His-272Phe-254, His-271
Electron Transfer RatePlant-specific kineticsAlgal-specific adaptations
Reference

Reconstitution Guidelines:

  1. Centrifuge lyophilized powder briefly before opening.

  2. Reconstitute in sterile water (0.1–1.0 mg/mL).

  3. Add 5–50% glycerol for long-term storage .

Stability Notes:

  • Avoid freeze-thaw cycles: Degradation observed after >3 cycles .

  • Buffer Compatibility: Tris/PBS-based buffers maintain solubility .

Biological Context in Sinapis alba

  • Gene Expression: The psbA gene is constitutively expressed, with post-transcriptional regulation linked to light availability .

  • Glucosinolate Pathway: While unrelated directly, S. alba’s transcriptome reveals tissue-specific expression of secondary metabolites (e.g., aliphatic glucosinolates in roots), providing context for studying photosynthetic protein interactions .

  • Phytochelatin Synthesis: High root expression of phytochelatin synthase suggests compartmentalized detoxification pathways, potentially influencing recombinant protein stability studies .

Limitations and Future Directions

  • Functional Studies: No in vivo activity data available; structural studies limited to SDS-PAGE.

  • Thermostability: Uncharacterized; algal homologs show higher thermal tolerance .

  • Industrial Potential: Untested in bioengineering applications (e.g., biofuel production).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize developing it.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; 32 kDa thylakoid membrane protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Sinapis alba (White mustard) (Brassica hirta)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the expression of Photosystem II-related genes vary across different tissues in Sinapis alba?

Transcriptome analysis of Sinapis alba reveals distinct expression patterns of photosynthesis-related genes across different plant tissues. Genes predominantly expressed in leaf tissues are significantly enriched in photosynthesis and carbon fixation-related pathways compared to stems and roots . This tissue-specific expression pattern is logical given that leaves are the primary photosynthetic organs.

The differential expression of these genes reflects the specialized functions of each tissue type. While 3,489 unigenes were predominantly expressed in leaves, only 1,361 were predominantly expressed in stems, and 8,482 were predominantly expressed in roots . The high number of predominantly expressed genes in roots indicates more specialized functions in this tissue, including those related to nutrient acquisition and stress responses.

What are the optimal storage conditions for recombinant Sinapis alba Photosystem Q(B) protein?

For optimal storage of recombinant Sinapis alba Photosystem Q(B) protein, the following protocol is recommended based on standard recombinant protein handling practices:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Avoid repeated freezing and thawing cycles as this can degrade protein structure and function

  • Working aliquots can be stored at 4°C for up to one week

  • The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability

These storage recommendations are designed to maintain protein stability and functionality for experimental applications.

How can EPR spectroscopy be utilized to measure the redox potential of the Q(B) site in Photosystem II of Sinapis alba?

Electron Paramagnetic Resonance (EPR) spectroscopy provides a powerful method for measuring the redox potentials of the Q(B) site in Photosystem II. Based on methodologies employed with PSII from Thermosynechococcus elongatus, a similar approach can be applied to Sinapis alba Photosystem Q(B) protein.

Methodological approach:

  • Sample preparation: Isolate PSII complexes from Sinapis alba through thylakoid membrane solubilization and subsequent purification steps.

  • Redox titration setup:

    • Establish a series of ambient redox potentials using mediators that cover the potential range of interest (typically -100 to +200 mV for QB measurements)

    • Ensure samples contain appropriate mediators (e.g., duroquinone, phenazine methosulfate) that facilitate electron transfer but do not interfere with the EPR signals

  • Measurements:

    • Monitor the semiquinone signal (QB- −) at approximately g = 1.8-2.0

    • Perform measurements at cryogenic temperatures (~15K) to trap the semiquinone state

    • Track signal intensity across the redox potential range

  • Data analysis:

    • Plot the normalized signal intensity versus potential

    • Fit to a Nernst equation for a one-electron process to determine Em of QB/QB- −

    • For the second electron transfer (QB- −/QBH2), additional pH-dependent measurements are necessary

In previous studies with thermophilic cyanobacteria, this approach yielded Em values of approximately +90 mV for QB/QB- − and +40 mV for QB- −/QBH2 . These values revealed that the semiquinone QB- − is thermodynamically stabilized and has a relatively high potential, which minimizes back-reactions and prevents electrons from leaking onto O2 .

What methodologies can be employed to study the impact of heavy metal stress on the function of Photosystem Q(B) protein in Sinapis alba?

Studying the impact of heavy metal stress on Photosystem Q(B) protein function in Sinapis alba requires a multi-faceted approach combining physiological, biochemical, and molecular techniques:

Experimental design for heavy metal stress studies:

  • Hydroponic cultivation system:

    • Grow Sinapis alba plants in nutrient solutions containing controlled concentrations of heavy metals (e.g., thallium, which has been shown to affect photosynthesis in S. alba)

    • Include appropriate control plants grown without heavy metal exposure

  • Chlorophyll fluorescence measurements:

    • Utilize pulse-amplitude-modulated (PAM) fluorometry to assess PSII functionality

    • Measure parameters such as Fv/Fm (maximum quantum efficiency), ΦPSII (effective quantum yield), and NPQ (non-photochemical quenching)

    • Dark-adapt plants for at least 20 minutes before measurement to ensure stable Fv/Fm values

  • Electron transport rate analysis:

    • Measure oxygen evolution rates using a Clark-type electrode

    • Assess electron flow through different segments of the photosynthetic electron transport chain using specific electron donors and acceptors

  • Protein expression and modification analysis:

    • Isolate thylakoid membranes and perform Western blot analysis targeting the D1 protein (Photosystem Q(B) protein)

    • Assess potential changes in D1 protein turnover rates under metal stress

    • Investigate post-translational modifications of the D1 protein

  • Gene expression analysis:

    • Perform real-time qPCR to quantify expression levels of the psbA gene encoding the D1 protein

    • Compare expression levels between control and heavy metal-stressed plants

Research on thallium exposure in Sinapis alba has shown inhibition of photosynthetic processes, which may involve direct or indirect effects on the Photosystem Q(B) protein . As S. alba is known for its ability to accumulate high concentrations of thallium, understanding the molecular mechanisms of tolerance involving the photosynthetic apparatus is crucial for phytoremediation applications .

How can I optimize the expression and purification of recombinant Sinapis alba Photosystem Q(B) protein in a heterologous system?

Optimizing the expression and purification of membrane proteins like the Photosystem Q(B) protein presents unique challenges due to their hydrophobic nature. Here is a comprehensive methodology for heterologous expression and purification:

Expression system selection:

  • E. coli-based systems:

    • Use specialized strains such as C41(DE3) or C43(DE3) designed for membrane protein expression

    • Consider fusion with solubility-enhancing tags like MBP (maltose-binding protein) or SUMO

  • Eukaryotic alternatives:

    • Yeast systems (Pichia pastoris) may provide better folding environment

    • Insect cell expression (Sf9 or Hi5 cells) may be appropriate for complex membrane proteins

Expression optimization:

  • Temperature modulation:

    • Lower expression temperature (16-20°C) to reduce aggregation

    • Extend expression time (24-48 hours) at reduced temperature

  • Induction parameters:

    • Test various inducer concentrations (0.1-1.0 mM IPTG for E. coli)

    • Evaluate cell density at induction time (typically OD600 0.6-0.8)

  • Media composition:

    • Supplement with additives known to enhance membrane protein expression (e.g., 1% glycerol, 5 mM betaine)

    • Consider auto-induction media for gradual protein expression

Solubilization and purification:

  • Membrane isolation:

    • Disrupt cells using sonication or homogenization

    • Isolate membrane fraction through ultracentrifugation

  • Detergent screening:

    • Test multiple detergents (DDM, LMNG, CHAPS) for efficient solubilization

    • Perform small-scale extractions to determine optimal detergent-to-protein ratio

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) as initial capture step

    • Size exclusion chromatography (SEC) for further purification and assessment of protein monodispersity

    • Consider ion exchange chromatography as an intermediate step if necessary

  • Protein quality assessment:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Circular dichroism to verify proper secondary structure

    • Functionality assessment through binding assays with plastoquinone analogs

The complete amino acid sequence of the target protein (as provided in section 1.1) should be analyzed for potential expression challenges, such as rare codons or hydrophobic regions that may require optimization .

How can understanding the Photosystem Q(B) protein in Sinapis alba contribute to phytoremediation applications?

Sinapis alba has demonstrated significant potential for phytoremediation, particularly for heavy metals like thallium . Understanding the Photosystem Q(B) protein's role in this context can enhance phytoremediation strategies through several mechanisms:

Molecular mechanisms linking Photosystem Q(B) to phytoremediation:

  • Stress response pathways:

    • The D1 protein (Photosystem Q(B) protein) is highly sensitive to oxidative stress induced by heavy metals

    • Its rapid turnover rate serves as an early indicator of cellular stress

    • Modifications to enhance D1 protein stability could improve plant tolerance to heavy metal exposure

  • Energy allocation during stress:

    • Heavy metal detoxification requires substantial energy input

    • Maintaining photosynthetic efficiency under stress conditions ensures adequate ATP and NADPH production

    • The optimization of electron flow through the QB site can improve energy availability for detoxification processes

  • Cross-talk with detoxification pathways:

    • Transcriptome analysis has revealed that roots of S. alba are enriched in genes potentially responsible for heavy metal chelating and detoxification

    • The glutathione and phytochelatin metabolic pathways, which are important for heavy metal tolerance, show tissue-specific expression patterns

    • In roots, glutathione is extensively converted to phytochelatin, while in leaves, it is converted to its oxidized form

  • Biomarkers for phytoremediation efficiency:

    • Changes in D1 protein turnover rates can serve as molecular biomarkers for assessing plant stress levels

    • Chlorophyll fluorescence parameters related to PSII function (Fv/Fm, ΦPSII) provide non-destructive measures of plant physiological status during phytoremediation

Transcriptome analysis has shown that S. alba roots accumulate the largest fraction of specifically and predominantly expressed genes, including those involved in pathways potentially responsible for heavy metal chelating and detoxification . This suggests that enhancing the plant's photosynthetic efficiency through optimized D1 protein function could support the energy requirements for these specialized root functions during phytoremediation.

How do recent findings on the genome of Sinapis alba inform our understanding of the evolution of photosynthetic proteins like the Q(B) protein?

Recent genomic studies of Sinapis alba provide valuable context for understanding the evolution of photosynthetic proteins, including the Photosystem Q(B) protein:

Evolutionary insights from S. alba genome:

  • Whole-genome triplication and selective constraints:

    • S. alba retains evidence of a whole-genome triplication event that occurred approximately 20.5 million years ago

    • Subgenome dominance has been observed in gene density, gene expression, and selective constraint

    • This genomic restructuring likely influenced the evolution of photosynthetic gene families, including those encoding Photosystem II components

  • Phylogenetic relationships within Brassicaceae:

    • S. alba diverged from the ancestor of Brassica and Raphanus approximately 12.5 million years ago

    • This divergence timing provides a framework for understanding when species-specific adaptations in photosynthetic proteins emerged

    • Comparisons of photosynthetic genes across these related species can reveal conserved functional domains versus regions under adaptive evolution

  • Chromosomal organization and synteny:

    • Two chromosomes of S. alba (Sal03 and Sal08) were completely collinear with two ancestral chromosomes proposed in the Ancestral Crucifer Karyotype model

    • This unusual conservation suggests these chromosomes may contain essential gene clusters, potentially including photosynthetic genes

    • Understanding synteny can help identify regulatory relationships between photosynthetic genes and other functional gene groups

  • Gene duplication patterns:

    • The de novo transcriptome of S. alba contains 47,972 unigenes

    • Analysis of gene families can reveal whether photosynthetic genes like psbA (encoding the D1 protein) underwent retention or loss following the whole-genome triplication

    • Differential retention of duplicated genes often indicates functional specialization or dosage requirements

These genomic insights provide an evolutionary context for understanding the Photosystem Q(B) protein in S. alba and how it may differ functionally from homologs in related species. The relatively ancient lineage of S. alba within the Brassiceae tribe makes it a valuable model for studying the evolution of photosynthetic machinery in this economically important plant family .

What are common challenges in studying the function of Photosystem Q(B) protein in Sinapis alba, and how can they be addressed?

Studying the Photosystem Q(B) protein in Sinapis alba presents several technical challenges that require specific methodological approaches:

Challenge 1: Isolation of functional PSII complexes

  • Problem: The D1 protein is highly susceptible to degradation during isolation procedures.

  • Solution:

    • Perform all isolation steps at 4°C under dim green light

    • Include protease inhibitors (e.g., PMSF, leupeptin) in all buffers

    • Use glycerol (10-20%) as a stabilizing agent

    • Employ rapid isolation procedures to minimize exposure time

Challenge 2: Distinguishing between QB and QA signals in spectroscopic studies

  • Problem: The spectroscopic signals from the two quinone binding sites can overlap.

  • Solution:

    • Use site-directed inhibitors like DCMU to selectively block the QB site

    • Employ low-temperature EPR measurements at different microwave powers to discriminate between the two sites

    • Analyze the kinetics of signal decay to distinguish the faster QA- − from the more stable QB- −

Challenge 3: Measuring the rapid turnover of D1 protein under stress conditions

  • Problem: The D1 protein undergoes rapid degradation and replacement, especially under stress.

  • Solution:

    • Use pulse-chase experiments with labeled amino acids

    • Apply protein synthesis inhibitors like lincomycin to measure degradation rates

    • Perform Western blots with antibodies specific to different epitopes to track degradation patterns

Challenge 4: Assessing redox potential changes in vivo

  • Problem: Redox measurements are typically performed in vitro, which may not reflect the actual in vivo conditions.

  • Solution:

    • Develop in vivo probes using genetic fusion of redox-sensitive fluorescent proteins

    • Employ thermoluminescence measurements, which can provide insights into the energetics of charge recombination pathways in intact systems

    • Use electrochemical techniques in combination with isolated thylakoid membranes

Challenge 5: Correlating gene expression with protein function

  • Problem: Transcriptome data alone may not reflect protein abundance or activity.

  • Solution:

    • Combine transcriptome analysis with proteomic approaches

    • Measure post-translational modifications that might affect protein function

    • Develop activity assays specific to the Photosystem Q(B) protein function

These methodological approaches can help overcome the technical challenges in studying the Photosystem Q(B) protein in Sinapis alba, enabling more accurate assessment of its function and regulation under different conditions.

How can I investigate the impact of environmental stressors like microplastics on Photosystem Q(B) protein function in Sinapis alba?

Recent research has shown that environmental stressors like microplastics can affect plant development and physiology in Sinapis alba . Investigating their specific impact on Photosystem Q(B) protein function requires a comprehensive experimental approach:

Experimental design for microplastic impact studies:

  • Plant cultivation under controlled exposure:

    • Grow S. alba plants in soil containing defined concentrations of microplastics (e.g., polyester microfibres at 0.1% and 1% w/w)

    • Maintain appropriate control plants in microplastic-free soil

    • Monitor growth parameters throughout the plant life cycle

  • Photosynthetic efficiency measurements:

    • Measure chlorophyll fluorescence parameters (Fv/Fm) using pulse-amplitude modulation fluorometry

    • Dark-adapt plants for at least 20 minutes before measurement

    • Track changes in these parameters throughout plant development

  • D1 protein turnover analysis:

    • Isolate thylakoid membranes from plants at different growth stages

    • Quantify D1 protein levels using Western blotting

    • Assess D1 protein synthesis and degradation rates using pulse-chase labeling

  • Electron transport measurements:

    • Measure electron transport rates through PSII using oxygen evolution measurements

    • Determine the efficiency of electron transfer from QA to QB

    • Assess the impact on plastoquinone pool redox state

  • Gene expression analysis:

    • Quantify psbA gene expression (encoding D1 protein) using RT-qPCR

    • Compare expression levels between control and microplastic-exposed plants

    • Correlate gene expression changes with photosynthetic parameters

  • Reactive oxygen species (ROS) quantification:

    • Measure ROS levels in chloroplasts using fluorescent probes

    • Assess oxidative damage to D1 protein through carbonyl group quantification

    • Evaluate antioxidant enzyme activities in response to stress

Research has shown that polyester microfibres can act as a stressor to S. alba, changing chlorophyll fluorescence values and reducing flower production . These effects could be mediated through impacts on photosynthetic efficiency, potentially involving changes in D1 protein function or turnover. The observed reduction in seed yield (approximately 20% lower seed-to-pod ratio in microplastic-exposed plants) highlights the potential agricultural significance of these effects.

What analytical techniques can be used to study the interaction between the recombinant Photosystem Q(B) protein and plastoquinone molecules?

Investigating the interactions between recombinant Photosystem Q(B) protein and plastoquinone molecules requires sophisticated biophysical and biochemical techniques:

Analytical approaches for studying protein-quinone interactions:

  • Site-directed mutagenesis and functional analysis:

    • Generate specific mutations in the QB binding pocket of the recombinant D1 protein

    • Express and purify the mutant proteins

    • Assess quinone binding affinities and electron transfer rates for each mutant

    • Correlate structural changes with functional alterations

  • EPR spectroscopy:

    • Use continuous wave EPR to detect semiquinone radical formation

    • Apply pulsed EPR techniques (ENDOR, ESEEM) to study the local environment of the semiquinone

    • Determine hyperfine couplings to identify specific amino acid residues interacting with the quinone

    • Measure relaxation times to assess the distance between the semiquinone and nearby cofactors

  • X-ray crystallography and cryo-EM:

    • Attempt crystallization of the recombinant D1 protein with bound plastoquinone

    • Use cryo-electron microscopy as an alternative approach for structural determination

    • Identify key residues involved in plastoquinone binding and orientation

  • Isothermal titration calorimetry (ITC):

    • Measure binding thermodynamics (ΔH, ΔS, ΔG) for plastoquinone and analogs

    • Determine binding constants (Kd) under different pH and ionic strength conditions

    • Compare affinities for oxidized (PQ) versus reduced (PQH2) forms

  • Surface plasmon resonance (SPR):

    • Immobilize the recombinant D1 protein on a sensor chip

    • Measure real-time binding kinetics of plastoquinone and analogs

    • Determine association (kon) and dissociation (koff) rate constants

  • Computational approaches:

    • Perform molecular docking simulations to predict plastoquinone binding poses

    • Use molecular dynamics to study the dynamic behavior of the QB binding pocket

    • Calculate binding energies for different plastoquinone analogs

Previous research on the thermodynamics of QB in PSII has shown that PQ is approximately 50 times more tightly bound than PQH2, with a difference in midpoint potentials (ΔE ≈ 50 meV) representing the driving force for QBH2 release into the plastoquinone pool . This thermodynamic tuning optimizes PSII function over a wide range of plastoquinone pool reduction states while minimizing back-reactions and side reactions with O2 .

What are the most promising research frontiers for understanding and utilizing the Photosystem Q(B) protein from Sinapis alba?

Based on current knowledge and technological advances, several frontier areas for Photosystem Q(B) protein research in Sinapis alba show particular promise:

  • Structural biology approaches:

    • High-resolution structural determination of S. alba D1 protein using advances in cryo-EM

    • Time-resolved crystallography to capture intermediate states during electron transfer

    • Structure-guided engineering of the QB binding site for enhanced electron transfer efficiency

  • Synthetic biology applications:

    • Engineering modified D1 proteins with altered redox properties for improved photosynthetic efficiency

    • Development of bio-hybrid devices incorporating the QB site for artificial photosynthesis

    • Creation of synthetic electron transport chains with optimized QB sites for bioenergy applications

  • Environmental adaptation mechanisms:

    • Investigation of D1 protein variants across S. alba ecotypes adapted to different environmental conditions

    • Understanding evolutionary adaptations of the QB site in response to varying light and temperature regimes

    • Comparative genomics of D1 protein across Brassicaceae to identify selection signatures

  • Integration with phytoremediation technology:

    • Development of S. alba variants with enhanced D1 protein stability under heavy metal stress

    • Creation of biological sensors using D1 protein modifications to detect environmental pollutants

    • Understanding the energy allocation between photosynthesis and detoxification pathways

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics) to understand D1 protein regulation

    • Network analysis of photosynthetic gene expression in relation to other cellular processes

    • Development of predictive models for D1 protein turnover under changing environmental conditions

The recent advances in genome sequencing of Sinapis alba and the accumulation of transcriptome data provide powerful resources for these future research directions, allowing researchers to explore the molecular basis of photosynthetic efficiency and stress tolerance in this important crop species.

How might emerging techniques in structural biology and biophysics advance our understanding of the Photosystem Q(B) protein in Sinapis alba?

Emerging techniques in structural biology and biophysics offer unprecedented opportunities to deepen our understanding of the Photosystem Q(B) protein:

  • Time-resolved serial femtosecond crystallography (TR-SFX):

    • Uses X-ray free electron lasers (XFELs) to capture ultrafast structural changes

    • Can potentially visualize electron transfer events within the D1 protein in real-time

    • May reveal transient conformational changes during plastoquinone reduction

  • Cryo-electron tomography (cryo-ET):

    • Enables visualization of the D1 protein in its native membrane environment

    • Can reveal how the protein is organized within the thylakoid membrane

    • Provides insights into supramolecular organization of PSII complexes

  • Single-molecule spectroscopy:

    • Allows observation of individual electron transfer events

    • Can detect heterogeneity in electron transfer rates not visible in ensemble measurements

    • May reveal rare or transient states in the electron transfer process

  • Advanced EPR techniques:

    • DEER (Double Electron-Electron Resonance) for measuring distances between cofactors

    • Rapid-freeze quench EPR to trap short-lived intermediates

    • High-field EPR for enhanced resolution of g-tensor components

  • Neutron crystallography:

    • Can locate hydrogen atoms and protonation states critical for understanding proton-coupled electron transfer

    • Distinguishes between hydrogen and deuterium, enabling mechanistic studies using H/D exchange

    • May reveal the proton transfer pathway associated with plastoquinone reduction

  • Integrative structural biology:

    • Combines data from multiple techniques (X-ray, NMR, cryo-EM, mass spectrometry, computational modeling)

    • Provides comprehensive structural models even when individual techniques have limitations

    • Can incorporate dynamics and ensemble behavior into structural models

These advanced techniques could help resolve longstanding questions about the mechanism of electron transfer at the QB site, the determinants of binding specificity for plastoquinone, and the structural basis for the thermodynamic tuning of the QB site observed in previous studies .

How can cross-disciplinary approaches integrate knowledge of Photosystem Q(B) protein function with broader agricultural and environmental applications?

Integrating knowledge of Photosystem Q(B) protein function with broader applications requires cross-disciplinary approaches that bridge molecular biology with agricultural, environmental, and biotechnological sciences:

  • Crop improvement strategies:

    • Apply knowledge of D1 protein function to develop crops with enhanced photosynthetic efficiency

    • Screen germplasm collections for natural variations in the psbA gene that confer improved stress tolerance

    • Utilize precise genome editing tools to introduce beneficial modifications to the D1 protein

  • Environmental monitoring systems:

    • Develop biosensors based on D1 protein responses to environmental pollutants

    • Create early warning systems for crop stress based on photosynthetic efficiency measurements

    • Design high-throughput screening platforms to assess soil contaminant effects on photosynthesis

  • Sustainable agriculture practices:

    • Optimize cultivation conditions based on understanding of D1 protein turnover and repair cycles

    • Develop precision agriculture approaches that minimize photosynthetic inhibition

    • Create decision support tools for farmers based on photosynthetic efficiency monitoring

  • Bioremediation technology enhancement:

    • Design improved phytoremediation systems using S. alba variants with optimized energy allocation

    • Develop plant-microbial consortia that protect photosynthetic function during remediation

    • Create mathematical models to predict remediation efficiency based on photosynthetic parameters

  • Bioenergy applications:

    • Engineer modified D1 proteins optimized for hydrogen production

    • Develop artificial photosynthetic systems inspired by the QB site architecture

    • Create bio-hybrid devices that couple natural photosystems with synthetic catalysts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.