Species: Sinapis alba (White mustard)
Expression System: Escherichia coli
Tag: N-terminal His tag
UniProt ID: P11848
The 343-residue sequence begins with:
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEA...
Photosystem II core: Binds plastoquinone (Q<sub>B</sub>) for electron transfer .
Transmembrane regions: Critical for integration into thylakoid membranes .
SDS-PAGE analysis: Primary application for purity validation .
Antigen production: Potential use in antibody generation (implied by ELISA-compatible formats) .
A homolog in Prorocentrum micans (UniProt Q9TM72) shares 78% sequence identity but differs in key regions:
Centrifuge lyophilized powder briefly before opening.
Reconstitute in sterile water (0.1–1.0 mg/mL).
Avoid freeze-thaw cycles: Degradation observed after >3 cycles .
Buffer Compatibility: Tris/PBS-based buffers maintain solubility .
Gene Expression: The psbA gene is constitutively expressed, with post-transcriptional regulation linked to light availability .
Glucosinolate Pathway: While unrelated directly, S. alba’s transcriptome reveals tissue-specific expression of secondary metabolites (e.g., aliphatic glucosinolates in roots), providing context for studying photosynthetic protein interactions .
Phytochelatin Synthesis: High root expression of phytochelatin synthase suggests compartmentalized detoxification pathways, potentially influencing recombinant protein stability studies .
Transcriptome analysis of Sinapis alba reveals distinct expression patterns of photosynthesis-related genes across different plant tissues. Genes predominantly expressed in leaf tissues are significantly enriched in photosynthesis and carbon fixation-related pathways compared to stems and roots . This tissue-specific expression pattern is logical given that leaves are the primary photosynthetic organs.
The differential expression of these genes reflects the specialized functions of each tissue type. While 3,489 unigenes were predominantly expressed in leaves, only 1,361 were predominantly expressed in stems, and 8,482 were predominantly expressed in roots . The high number of predominantly expressed genes in roots indicates more specialized functions in this tissue, including those related to nutrient acquisition and stress responses.
For optimal storage of recombinant Sinapis alba Photosystem Q(B) protein, the following protocol is recommended based on standard recombinant protein handling practices:
Store at -20°C for regular use
For extended storage, conserve at -20°C or -80°C
Avoid repeated freezing and thawing cycles as this can degrade protein structure and function
Working aliquots can be stored at 4°C for up to one week
The protein is typically supplied in a Tris-based buffer with 50% glycerol, optimized for stability
These storage recommendations are designed to maintain protein stability and functionality for experimental applications.
Electron Paramagnetic Resonance (EPR) spectroscopy provides a powerful method for measuring the redox potentials of the Q(B) site in Photosystem II. Based on methodologies employed with PSII from Thermosynechococcus elongatus, a similar approach can be applied to Sinapis alba Photosystem Q(B) protein.
Methodological approach:
Sample preparation: Isolate PSII complexes from Sinapis alba through thylakoid membrane solubilization and subsequent purification steps.
Redox titration setup:
Establish a series of ambient redox potentials using mediators that cover the potential range of interest (typically -100 to +200 mV for QB measurements)
Ensure samples contain appropriate mediators (e.g., duroquinone, phenazine methosulfate) that facilitate electron transfer but do not interfere with the EPR signals
Measurements:
Monitor the semiquinone signal (QB- −) at approximately g = 1.8-2.0
Perform measurements at cryogenic temperatures (~15K) to trap the semiquinone state
Track signal intensity across the redox potential range
Data analysis:
Plot the normalized signal intensity versus potential
Fit to a Nernst equation for a one-electron process to determine Em of QB/QB- −
For the second electron transfer (QB- −/QBH2), additional pH-dependent measurements are necessary
In previous studies with thermophilic cyanobacteria, this approach yielded Em values of approximately +90 mV for QB/QB- − and +40 mV for QB- −/QBH2 . These values revealed that the semiquinone QB- − is thermodynamically stabilized and has a relatively high potential, which minimizes back-reactions and prevents electrons from leaking onto O2 .
Studying the impact of heavy metal stress on Photosystem Q(B) protein function in Sinapis alba requires a multi-faceted approach combining physiological, biochemical, and molecular techniques:
Experimental design for heavy metal stress studies:
Hydroponic cultivation system:
Chlorophyll fluorescence measurements:
Utilize pulse-amplitude-modulated (PAM) fluorometry to assess PSII functionality
Measure parameters such as Fv/Fm (maximum quantum efficiency), ΦPSII (effective quantum yield), and NPQ (non-photochemical quenching)
Dark-adapt plants for at least 20 minutes before measurement to ensure stable Fv/Fm values
Electron transport rate analysis:
Measure oxygen evolution rates using a Clark-type electrode
Assess electron flow through different segments of the photosynthetic electron transport chain using specific electron donors and acceptors
Protein expression and modification analysis:
Isolate thylakoid membranes and perform Western blot analysis targeting the D1 protein (Photosystem Q(B) protein)
Assess potential changes in D1 protein turnover rates under metal stress
Investigate post-translational modifications of the D1 protein
Gene expression analysis:
Perform real-time qPCR to quantify expression levels of the psbA gene encoding the D1 protein
Compare expression levels between control and heavy metal-stressed plants
Research on thallium exposure in Sinapis alba has shown inhibition of photosynthetic processes, which may involve direct or indirect effects on the Photosystem Q(B) protein . As S. alba is known for its ability to accumulate high concentrations of thallium, understanding the molecular mechanisms of tolerance involving the photosynthetic apparatus is crucial for phytoremediation applications .
Optimizing the expression and purification of membrane proteins like the Photosystem Q(B) protein presents unique challenges due to their hydrophobic nature. Here is a comprehensive methodology for heterologous expression and purification:
Expression system selection:
E. coli-based systems:
Use specialized strains such as C41(DE3) or C43(DE3) designed for membrane protein expression
Consider fusion with solubility-enhancing tags like MBP (maltose-binding protein) or SUMO
Eukaryotic alternatives:
Yeast systems (Pichia pastoris) may provide better folding environment
Insect cell expression (Sf9 or Hi5 cells) may be appropriate for complex membrane proteins
Expression optimization:
Temperature modulation:
Lower expression temperature (16-20°C) to reduce aggregation
Extend expression time (24-48 hours) at reduced temperature
Induction parameters:
Test various inducer concentrations (0.1-1.0 mM IPTG for E. coli)
Evaluate cell density at induction time (typically OD600 0.6-0.8)
Media composition:
Supplement with additives known to enhance membrane protein expression (e.g., 1% glycerol, 5 mM betaine)
Consider auto-induction media for gradual protein expression
Solubilization and purification:
Membrane isolation:
Disrupt cells using sonication or homogenization
Isolate membrane fraction through ultracentrifugation
Detergent screening:
Test multiple detergents (DDM, LMNG, CHAPS) for efficient solubilization
Perform small-scale extractions to determine optimal detergent-to-protein ratio
Purification strategy:
Immobilized metal affinity chromatography (IMAC) as initial capture step
Size exclusion chromatography (SEC) for further purification and assessment of protein monodispersity
Consider ion exchange chromatography as an intermediate step if necessary
Protein quality assessment:
SDS-PAGE and Western blotting to confirm identity and purity
Circular dichroism to verify proper secondary structure
Functionality assessment through binding assays with plastoquinone analogs
The complete amino acid sequence of the target protein (as provided in section 1.1) should be analyzed for potential expression challenges, such as rare codons or hydrophobic regions that may require optimization .
Sinapis alba has demonstrated significant potential for phytoremediation, particularly for heavy metals like thallium . Understanding the Photosystem Q(B) protein's role in this context can enhance phytoremediation strategies through several mechanisms:
Molecular mechanisms linking Photosystem Q(B) to phytoremediation:
Stress response pathways:
The D1 protein (Photosystem Q(B) protein) is highly sensitive to oxidative stress induced by heavy metals
Its rapid turnover rate serves as an early indicator of cellular stress
Modifications to enhance D1 protein stability could improve plant tolerance to heavy metal exposure
Energy allocation during stress:
Heavy metal detoxification requires substantial energy input
Maintaining photosynthetic efficiency under stress conditions ensures adequate ATP and NADPH production
The optimization of electron flow through the QB site can improve energy availability for detoxification processes
Cross-talk with detoxification pathways:
Transcriptome analysis has revealed that roots of S. alba are enriched in genes potentially responsible for heavy metal chelating and detoxification
The glutathione and phytochelatin metabolic pathways, which are important for heavy metal tolerance, show tissue-specific expression patterns
In roots, glutathione is extensively converted to phytochelatin, while in leaves, it is converted to its oxidized form
Biomarkers for phytoremediation efficiency:
Changes in D1 protein turnover rates can serve as molecular biomarkers for assessing plant stress levels
Chlorophyll fluorescence parameters related to PSII function (Fv/Fm, ΦPSII) provide non-destructive measures of plant physiological status during phytoremediation
Transcriptome analysis has shown that S. alba roots accumulate the largest fraction of specifically and predominantly expressed genes, including those involved in pathways potentially responsible for heavy metal chelating and detoxification . This suggests that enhancing the plant's photosynthetic efficiency through optimized D1 protein function could support the energy requirements for these specialized root functions during phytoremediation.
Recent genomic studies of Sinapis alba provide valuable context for understanding the evolution of photosynthetic proteins, including the Photosystem Q(B) protein:
Evolutionary insights from S. alba genome:
Whole-genome triplication and selective constraints:
S. alba retains evidence of a whole-genome triplication event that occurred approximately 20.5 million years ago
Subgenome dominance has been observed in gene density, gene expression, and selective constraint
This genomic restructuring likely influenced the evolution of photosynthetic gene families, including those encoding Photosystem II components
Phylogenetic relationships within Brassicaceae:
S. alba diverged from the ancestor of Brassica and Raphanus approximately 12.5 million years ago
This divergence timing provides a framework for understanding when species-specific adaptations in photosynthetic proteins emerged
Comparisons of photosynthetic genes across these related species can reveal conserved functional domains versus regions under adaptive evolution
Chromosomal organization and synteny:
Two chromosomes of S. alba (Sal03 and Sal08) were completely collinear with two ancestral chromosomes proposed in the Ancestral Crucifer Karyotype model
This unusual conservation suggests these chromosomes may contain essential gene clusters, potentially including photosynthetic genes
Understanding synteny can help identify regulatory relationships between photosynthetic genes and other functional gene groups
Gene duplication patterns:
The de novo transcriptome of S. alba contains 47,972 unigenes
Analysis of gene families can reveal whether photosynthetic genes like psbA (encoding the D1 protein) underwent retention or loss following the whole-genome triplication
Differential retention of duplicated genes often indicates functional specialization or dosage requirements
These genomic insights provide an evolutionary context for understanding the Photosystem Q(B) protein in S. alba and how it may differ functionally from homologs in related species. The relatively ancient lineage of S. alba within the Brassiceae tribe makes it a valuable model for studying the evolution of photosynthetic machinery in this economically important plant family .
Studying the Photosystem Q(B) protein in Sinapis alba presents several technical challenges that require specific methodological approaches:
Problem: The D1 protein is highly susceptible to degradation during isolation procedures.
Solution:
Perform all isolation steps at 4°C under dim green light
Include protease inhibitors (e.g., PMSF, leupeptin) in all buffers
Use glycerol (10-20%) as a stabilizing agent
Employ rapid isolation procedures to minimize exposure time
Problem: The spectroscopic signals from the two quinone binding sites can overlap.
Solution:
Use site-directed inhibitors like DCMU to selectively block the QB site
Employ low-temperature EPR measurements at different microwave powers to discriminate between the two sites
Analyze the kinetics of signal decay to distinguish the faster QA- − from the more stable QB- −
Problem: The D1 protein undergoes rapid degradation and replacement, especially under stress.
Solution:
Use pulse-chase experiments with labeled amino acids
Apply protein synthesis inhibitors like lincomycin to measure degradation rates
Perform Western blots with antibodies specific to different epitopes to track degradation patterns
Problem: Redox measurements are typically performed in vitro, which may not reflect the actual in vivo conditions.
Solution:
Develop in vivo probes using genetic fusion of redox-sensitive fluorescent proteins
Employ thermoluminescence measurements, which can provide insights into the energetics of charge recombination pathways in intact systems
Use electrochemical techniques in combination with isolated thylakoid membranes
Problem: Transcriptome data alone may not reflect protein abundance or activity.
Solution:
Combine transcriptome analysis with proteomic approaches
Measure post-translational modifications that might affect protein function
Develop activity assays specific to the Photosystem Q(B) protein function
These methodological approaches can help overcome the technical challenges in studying the Photosystem Q(B) protein in Sinapis alba, enabling more accurate assessment of its function and regulation under different conditions.
Recent research has shown that environmental stressors like microplastics can affect plant development and physiology in Sinapis alba . Investigating their specific impact on Photosystem Q(B) protein function requires a comprehensive experimental approach:
Experimental design for microplastic impact studies:
Plant cultivation under controlled exposure:
Photosynthetic efficiency measurements:
D1 protein turnover analysis:
Isolate thylakoid membranes from plants at different growth stages
Quantify D1 protein levels using Western blotting
Assess D1 protein synthesis and degradation rates using pulse-chase labeling
Electron transport measurements:
Measure electron transport rates through PSII using oxygen evolution measurements
Determine the efficiency of electron transfer from QA to QB
Assess the impact on plastoquinone pool redox state
Gene expression analysis:
Quantify psbA gene expression (encoding D1 protein) using RT-qPCR
Compare expression levels between control and microplastic-exposed plants
Correlate gene expression changes with photosynthetic parameters
Reactive oxygen species (ROS) quantification:
Measure ROS levels in chloroplasts using fluorescent probes
Assess oxidative damage to D1 protein through carbonyl group quantification
Evaluate antioxidant enzyme activities in response to stress
Research has shown that polyester microfibres can act as a stressor to S. alba, changing chlorophyll fluorescence values and reducing flower production . These effects could be mediated through impacts on photosynthetic efficiency, potentially involving changes in D1 protein function or turnover. The observed reduction in seed yield (approximately 20% lower seed-to-pod ratio in microplastic-exposed plants) highlights the potential agricultural significance of these effects.
Investigating the interactions between recombinant Photosystem Q(B) protein and plastoquinone molecules requires sophisticated biophysical and biochemical techniques:
Analytical approaches for studying protein-quinone interactions:
Site-directed mutagenesis and functional analysis:
Generate specific mutations in the QB binding pocket of the recombinant D1 protein
Express and purify the mutant proteins
Assess quinone binding affinities and electron transfer rates for each mutant
Correlate structural changes with functional alterations
EPR spectroscopy:
Use continuous wave EPR to detect semiquinone radical formation
Apply pulsed EPR techniques (ENDOR, ESEEM) to study the local environment of the semiquinone
Determine hyperfine couplings to identify specific amino acid residues interacting with the quinone
Measure relaxation times to assess the distance between the semiquinone and nearby cofactors
X-ray crystallography and cryo-EM:
Attempt crystallization of the recombinant D1 protein with bound plastoquinone
Use cryo-electron microscopy as an alternative approach for structural determination
Identify key residues involved in plastoquinone binding and orientation
Isothermal titration calorimetry (ITC):
Measure binding thermodynamics (ΔH, ΔS, ΔG) for plastoquinone and analogs
Determine binding constants (Kd) under different pH and ionic strength conditions
Compare affinities for oxidized (PQ) versus reduced (PQH2) forms
Surface plasmon resonance (SPR):
Immobilize the recombinant D1 protein on a sensor chip
Measure real-time binding kinetics of plastoquinone and analogs
Determine association (kon) and dissociation (koff) rate constants
Computational approaches:
Perform molecular docking simulations to predict plastoquinone binding poses
Use molecular dynamics to study the dynamic behavior of the QB binding pocket
Calculate binding energies for different plastoquinone analogs
Previous research on the thermodynamics of QB in PSII has shown that PQ is approximately 50 times more tightly bound than PQH2, with a difference in midpoint potentials (ΔE ≈ 50 meV) representing the driving force for QBH2 release into the plastoquinone pool . This thermodynamic tuning optimizes PSII function over a wide range of plastoquinone pool reduction states while minimizing back-reactions and side reactions with O2 .
Based on current knowledge and technological advances, several frontier areas for Photosystem Q(B) protein research in Sinapis alba show particular promise:
Structural biology approaches:
High-resolution structural determination of S. alba D1 protein using advances in cryo-EM
Time-resolved crystallography to capture intermediate states during electron transfer
Structure-guided engineering of the QB binding site for enhanced electron transfer efficiency
Synthetic biology applications:
Engineering modified D1 proteins with altered redox properties for improved photosynthetic efficiency
Development of bio-hybrid devices incorporating the QB site for artificial photosynthesis
Creation of synthetic electron transport chains with optimized QB sites for bioenergy applications
Environmental adaptation mechanisms:
Investigation of D1 protein variants across S. alba ecotypes adapted to different environmental conditions
Understanding evolutionary adaptations of the QB site in response to varying light and temperature regimes
Comparative genomics of D1 protein across Brassicaceae to identify selection signatures
Integration with phytoremediation technology:
Development of S. alba variants with enhanced D1 protein stability under heavy metal stress
Creation of biological sensors using D1 protein modifications to detect environmental pollutants
Understanding the energy allocation between photosynthesis and detoxification pathways
Systems biology approaches:
Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics) to understand D1 protein regulation
Network analysis of photosynthetic gene expression in relation to other cellular processes
Development of predictive models for D1 protein turnover under changing environmental conditions
The recent advances in genome sequencing of Sinapis alba and the accumulation of transcriptome data provide powerful resources for these future research directions, allowing researchers to explore the molecular basis of photosynthetic efficiency and stress tolerance in this important crop species.
Emerging techniques in structural biology and biophysics offer unprecedented opportunities to deepen our understanding of the Photosystem Q(B) protein:
Time-resolved serial femtosecond crystallography (TR-SFX):
Uses X-ray free electron lasers (XFELs) to capture ultrafast structural changes
Can potentially visualize electron transfer events within the D1 protein in real-time
May reveal transient conformational changes during plastoquinone reduction
Cryo-electron tomography (cryo-ET):
Enables visualization of the D1 protein in its native membrane environment
Can reveal how the protein is organized within the thylakoid membrane
Provides insights into supramolecular organization of PSII complexes
Single-molecule spectroscopy:
Allows observation of individual electron transfer events
Can detect heterogeneity in electron transfer rates not visible in ensemble measurements
May reveal rare or transient states in the electron transfer process
Advanced EPR techniques:
DEER (Double Electron-Electron Resonance) for measuring distances between cofactors
Rapid-freeze quench EPR to trap short-lived intermediates
High-field EPR for enhanced resolution of g-tensor components
Neutron crystallography:
Can locate hydrogen atoms and protonation states critical for understanding proton-coupled electron transfer
Distinguishes between hydrogen and deuterium, enabling mechanistic studies using H/D exchange
May reveal the proton transfer pathway associated with plastoquinone reduction
Integrative structural biology:
Combines data from multiple techniques (X-ray, NMR, cryo-EM, mass spectrometry, computational modeling)
Provides comprehensive structural models even when individual techniques have limitations
Can incorporate dynamics and ensemble behavior into structural models
These advanced techniques could help resolve longstanding questions about the mechanism of electron transfer at the QB site, the determinants of binding specificity for plastoquinone, and the structural basis for the thermodynamic tuning of the QB site observed in previous studies .
Integrating knowledge of Photosystem Q(B) protein function with broader applications requires cross-disciplinary approaches that bridge molecular biology with agricultural, environmental, and biotechnological sciences:
Crop improvement strategies:
Apply knowledge of D1 protein function to develop crops with enhanced photosynthetic efficiency
Screen germplasm collections for natural variations in the psbA gene that confer improved stress tolerance
Utilize precise genome editing tools to introduce beneficial modifications to the D1 protein
Environmental monitoring systems:
Develop biosensors based on D1 protein responses to environmental pollutants
Create early warning systems for crop stress based on photosynthetic efficiency measurements
Design high-throughput screening platforms to assess soil contaminant effects on photosynthesis
Sustainable agriculture practices:
Optimize cultivation conditions based on understanding of D1 protein turnover and repair cycles
Develop precision agriculture approaches that minimize photosynthetic inhibition
Create decision support tools for farmers based on photosynthetic efficiency monitoring
Bioremediation technology enhancement:
Design improved phytoremediation systems using S. alba variants with optimized energy allocation
Develop plant-microbial consortia that protect photosynthetic function during remediation
Create mathematical models to predict remediation efficiency based on photosynthetic parameters
Bioenergy applications:
Engineer modified D1 proteins optimized for hydrogen production
Develop artificial photosynthetic systems inspired by the QB site architecture
Create bio-hybrid devices that couple natural photosystems with synthetic catalysts