Recombinant Sindbis virus subtype Ockelbo Structural polyprotein, partial

Shipped with Ice Packs
In Stock

Description

Definition and Context

Recombinant Sindbis virus subtype Ockelbo structural polyprotein, partial refers to a truncated version of the non-structural polyprotein encoded by the SINV Ockelbo strain. It is produced via recombinant DNA technology, often using baculovirus or vaccinia virus expression systems . The Ockelbo virus itself is a Northern European variant of SINV, antigenically similar to South African SINV strains but distinct from the prototypic Egyptian AR339 strain .

Protein Composition

The partial structural polyprotein includes sequences from the non-structural (nsP1–nsP4) and structural (capsid, E3, E2, 6K/TF, E1) regions. Key domains include:

  • Capsid protease: Autocleaves from the polyprotein during translation .

  • E1 and E2 glycoproteins: Critical for host cell entry and fusion .

  • 6K/TF protein: Facilitates envelope protein processing and virion assembly .

A partial amino acid sequence of the recombinant polyprotein is provided below:

Sequence Segment (Residues 1–100)
MEKPVVNVDV DPQSPFVVQL QKSFPQFEVV AQQATPNDHA
NARAFSHLAS KLIELEVPTT ATILDIGSAP ARRMFSEHQY
HCVCPMRSPE DPDRMMKYAS KLAEKACKIT NKNLHEKIKD
LRTVLDTPDA ETPSLCFHND VTCNTRAEYS VMQDVYINAP
GTIYHQAMKG VRTLYWIGFD TTQFMFSAMA GSYPAYNTNW
Source: Recombinant protein datasheet .

Recombination Events

SINV-Ockelbo’s structural genes show recombination patterns, including:

  • Clade-specific divergence: Ockelbo clusters with South African SINV strains rather than the Egyptian AR339 strain .

  • Natural recombination: Evidence of recombination between SINV-I strains in Central Europe and Central Africa .

Evolutionary Insights

  • Ockelbo virus likely originated from a South African SINV lineage introduced to Northern Europe via migratory birds or human activity .

  • Recombination between SINV strains can occur via template switching during RNA replication, enhancing genetic diversity .

Functional Studies

  • Vaccinia-based expression: Recombinant SINV structural proteins expressed in vaccinia systems retain proper cleavage, glycosylation, and virion incorporation .

  • 2A protease fusion: Insertion of foot-and-mouth disease virus 2A protease into SINV structural polyproteins enables efficient cleavage of foreign proteins (e.g., GFP, VP7) .

Comparative Analysis

FeatureOckelbo VirusPrototypic SINV (AR339)
Geographic OriginNorthern EuropeEgypt
Structural HomologyCloser to South African SINVDivergent (17% nucleotide difference)
Recombination EventsDetected in nsP4 and E1 genesRare in natural strains

Research Tools

  • Vaccine development: Recombinant SINV structural proteins are used to study antibody neutralization and epitope mapping .

  • Vector systems: Chimeric SINV-Ross River viruses demonstrate the modularity of alphavirus structural proteins for gene delivery .

Challenges

  • Host adaptation: Mismatched structural and non-structural proteins in chimeric viruses reduce replication efficiency .

  • Stability: Recombinant SINV constructs require optimization for consistent expression in heterologous systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Structural polyprotein; p130
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
807-1245
Protein Length
Partial
Species
Sindbis virus subtype Ockelbo (strain Edsbyn 82-5) (OCKV) (Ockelbo virus)
Target Protein Sequence
YEHATTVPNVPQIPYKALVERAGYAPLNLEITVMSSEVLPSTNQEYITCKFTTVVPSPKV KCCGSLECQPAAHADYTCKVFGGVYPFMWGGAQCFCDSENSQMSEAYVELSADCATDHAQ AIKVHTAAMKVGLRIVYGNTTSFLDVYVNGVTPGTSKDLKVIAGPISASFTPFDHKVVIH RGLVYNYDFPEYGAMKPGVFGDIQATSLTSKDLIASTDIRLLKPSAKNVHVPYTQAASGF EMWKNNSGRPLQETAPFGCKIAVNPLRAVDCSYGNIPISIDIPNAAFIRTSDAPLVSTVK CDVSECTYSADFGGMATLQYVSDREGQCPVHSHSSTATLQESTVHVLEKGAVTVHFSTAS PQANFIVSLCGKKTTCNAECKPPADHIVSTPHKNDQEFQAAISKTSWSWLFALFGGASSL LIIGLTIFACSMMLTSTRR
Uniprot No.

Target Background

Function
The recombinant Sindbis virus subtype Ockelbo structural polyprotein forms an icosahedral capsid with T=4 symmetry. This capsid comprises 240 copies of the capsid protein, enveloped by a lipid membrane containing 80 spikes formed from E1-E2 heterodimer trimers. The capsid protein binds to the viral RNA genome near its ribosome-binding site, facilitating translation after genome release. It exhibits protease activity, autocatalytically cleaving from the nascent structural protein. Following self-cleavage, it transiently interacts with ribosomes before binding viral RNA and assembling into icosahedral core particles. This nucleocapsid associates with the cytoplasmic domain of the E2 spike glycoprotein at the cell membrane, culminating in budding and mature virion formation. During infection, virions attach to target cells, undergoing clathrin-mediated endocytosis and membrane fusion with the host endosomal membrane. This releases the nucleocapsid into the cytoplasm, triggering uncoating (likely initiated by capsid-ribosome interaction) for genomic RNA accessibility. The protein specifically inhibits interleukin-1 receptor-associated kinase 1 (IRAK1)-dependent signaling during viral entry, potentially evading innate immune responses before viral gene expression. The E3 protein provides the signal sequence for E3/E2 precursor translocation to the host endoplasmic reticulum. Furin-cleaved E3 remains associated with E1, protecting it at low pH during secretory pathway transport. Post-release, E3 is gradually released extracellularly. E2 plays a crucial role in viral attachment via cell receptor binding, processed from pE2 by furin at the cell membrane before budding, creating the E2-E1 heterodimer. pE2-E1 is stable, unlike the pH-labile E2-E1. Late pE2 processing likely prevents premature E1 fusion activation. E2's C-terminus undergoes palmitoylation-mediated reorientation, facilitating interaction with capsid proteins during budding. The 6K protein functions as a viroporin, influencing glycoprotein processing, cell permeabilization, and budding. It disrupts calcium homeostasis, potentially at the endoplasmic reticulum, increasing cytoplasmic calcium. Its lipophilicity suggests influence on lipid selection around glycoprotein transmembrane domains, impacting membrane deformability for budding. E1, a class II viral fusion protein, is fusion-inactive while bound to E2 in mature virions. Endosomal acidification post-endocytosis dissociates the E1/E2 heterodimer, activating E1 trimerization and fusion, releasing the nucleocapsid into the cytoplasm.
Subcellular Location
[Capsid protein]: Virion. Host cytoplasm. Host cell membrane. Host nucleus.; [Spike glycoprotein E2]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.; [6K protein]: Host cell membrane; Multi-pass membrane protein. Virion membrane; Multi-pass membrane protein.; [Spike glycoprotein E1]: Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the Sindbis virus subtype Ockelbo and how is it related to other alphaviruses?

Ockelbo virus was first isolated in 1982 in Sweden and is a causal agent of human disease characterized by arthritis, rash, and fever. It is antigenically and genomically very closely related to Sindbis virus, belonging to the Alphavirus genus within the Togaviridae family . Phylogenetic analysis has demonstrated that Ockelbo virus is more closely related to South African strains of Sindbis virus than to the prototypic Egyptian AR339 strain, suggesting that South African strains may have been introduced into Northern Europe by human activity or migratory birds to establish Ockelbo disease . Sindbis virus is widely distributed throughout Eurasia, Africa, and Oceania, with the Ockelbo strain representing a Northern European variant .

What is the structural polyprotein of Sindbis virus and what role does it play in the viral life cycle?

The structural polyprotein is a critical component of the Sindbis virus, encoded in the 3' portion of the viral genome. Sindbis viruses possess a positive single-stranded RNA genome approximately 11.7kb in length, which encodes both non-structural and structural proteins . The structural polyprotein, sometimes referred to as p130, undergoes proteolytic processing to generate the viral capsid protein and envelope glycoproteins that form the virus particle . The capsid protein encapsulates the viral RNA genome while the envelope proteins (including those derived from p62, which is further processed into E3/E2) mediate host cell receptor binding and membrane fusion during viral entry . This coordinated proteolytic processing is essential for proper virion assembly and infectivity.

How does the Ockelbo strain's structural polyprotein differ from other Sindbis virus strains?

The Ockelbo virus isolate (strain Edsbyn 82-5) shows high sequence similarity with other Sindbis virus strains, but with distinct differences. Comparative genomic analysis has revealed that the numbers of nucleotides and translated amino acids in most regions of the Ockelbo virus genome are identical to those of the prototype AR339 strain of Sindbis virus, with the exception of three small deletions and insertions in the C-terminal half of nsP3 and three single nucleotide insertions and deletions in the 3' end . Phylogenetic studies of the structural polyprotein sequences suggest that German SINV strains show 99.4-99.6% nucleotide identity with Swedish SINV strains, indicating close evolutionary relationships among European variants . These minor differences may contribute to variations in pathogenicity, host range, or transmission efficiency.

What are the optimal expression systems for producing recombinant Sindbis virus Ockelbo structural polyprotein?

For efficient expression of recombinant Sindbis virus Ockelbo structural polyprotein, researchers should consider several expression systems depending on research objectives:

Expression SystemAdvantagesLimitationsOptimal Applications
Mammalian cell systemsNative post-translational modifications; Proper protein foldingHigher cost; Longer production timeStructural studies; Immunogenicity research
Baculovirus/insect cellsHigher yield than mammalian cells; Similar post-translational modificationsSome modifications differ from mammalian systemAntigen preparation; Initial characterization
E. coli systemsRapid growth; Low cost; High yieldLimited post-translational modifications; Potential inclusion bodiesDomain-specific studies; Mutation analysis
Cell-free systemsRapid production; Avoids cellular toxicityLower yield; Higher costProtein interaction studies; High-throughput screening

For most structural and functional studies, mammalian expression systems are preferred as they most closely mimic the natural viral host environment . When expressing the complete structural polyprotein, researchers should include the native signal sequences and carefully optimize codon usage for the chosen expression system to maximize yield and proper folding.

How should researchers design experiments to study the immunogenic properties of recombinant Ockelbo structural polyprotein?

When designing experiments to study immunogenic properties of recombinant Ockelbo structural polyprotein, researchers should implement a multi-faceted approach:

  • Epitope mapping: Utilize overlapping peptide libraries spanning the entire structural polyprotein sequence to identify immunodominant B-cell and T-cell epitopes through ELISA, ELISpot, or flow cytometry-based assays.

  • Neutralization assays: Generate pseudotyped viruses or virus-like particles (VLPs) expressing the Ockelbo structural proteins to evaluate neutralizing antibody responses in both animal models and human sera from endemic regions.

  • Cross-reactivity studies: Compare immune responses against recombinant proteins from different Sindbis virus strains, including the closely related South African strains and the more distant AR339 prototype .

  • Animal models: Consider both mouse models for initial immunogenicity assessment and non-human primates for more translatable results. Document both humoral and cell-mediated immune responses, with particular attention to responses associated with protection versus those potentially involved in arthritogenic pathology.

  • Human sera analysis: Collect and analyze serum samples from patients in endemic regions such as Sweden, Finland, and Russian Karelia to evaluate natural immune responses . The 2018 outbreak in Finland (71 diagnosed cases) provides a valuable opportunity for studying human immune responses to contemporary circulating strains .

What are the key challenges in studying the structure-function relationship of the Ockelbo strain structural polyprotein?

Researchers face several significant challenges when investigating structure-function relationships of the Ockelbo strain structural polyprotein:

  • Proteolytic processing complexity: The structural polyprotein undergoes multiple precise cleavage events to generate functional viral proteins. Recapitulating these events in experimental systems requires careful design to maintain native cleavage sites and correct spatial organization .

  • Post-translational modifications: The envelope glycoproteins require specific glycosylation patterns for proper folding and function. Different expression systems may produce varying glycosylation profiles, potentially affecting structural and functional analyses .

  • Structural dynamics: The envelope proteins undergo conformational changes during the virus life cycle, particularly during receptor binding and membrane fusion. Capturing these different conformational states requires specialized techniques like cryo-electron microscopy combined with functional assays .

  • Strain-specific variations: The subtle sequence differences between Ockelbo and other Sindbis virus strains may impact structure-function relationships in ways that are difficult to predict . Comparative studies with multiple strains are needed to discern the functional significance of these variations.

  • Protein-protein interactions: The structural proteins interact with each other and with host factors. Mapping these interaction networks requires techniques like co-immunoprecipitation, proximity labeling, or yeast two-hybrid screening followed by functional validation.

How does the genetic variation in the Ockelbo structural polyprotein correlate with geographic distribution and virulence?

The genetic variation in Ockelbo structural polyprotein exhibits geographic patterns that provide insights into viral evolution and transmission routes. Phylogenetic analyses have established that Ockelbo virus is more closely related to South African strains of Sindbis virus than to the Egyptian prototype strain AR339 . This suggests a potential introduction of South African strains into Northern Europe, possibly through migratory birds or human travel.

Recent molecular epidemiological studies have demonstrated evidence of SINV strain transfer within Europe across regions with different epidemiological characteristics . The 2018 outbreak in Finland yielded several SINV isolates that were divergent from one another yet related to previous Finnish, Swedish, and German strains . This indicates ongoing evolution and periodic reintroduction of strains throughout Europe.

Analyses of German SINV strains isolated from mosquitoes have shown 99.4-99.6% nucleotide identity with Swedish SINV strains, establishing a close relationship between the newly described German SINV strains and the SINV strains (Ockelbo-Edsbyn and 95M116) circulating in Sweden . This genetic similarity suggests common evolutionary origins despite geographic separation.

The correlation between specific genetic variations and virulence remains incompletely understood, though the consistent association of genotype I with human disease in Northern Europe and South Africa suggests certain genetic determinants may enhance pathogenicity in humans .

What methodologies are most effective for detecting and characterizing Ockelbo virus in field-collected mosquitoes?

For effective detection and characterization of Ockelbo virus in field-collected mosquitoes, researchers should employ a comprehensive methodological approach:

  • Sample collection and processing:

    • Trap mosquitoes using CDC light traps or BG-Sentinel traps in endemic areas

    • Sort mosquitoes by species and pool similar species (typically 10-50 individuals per pool)

    • Homogenize mosquito pools in appropriate buffer with sterile beads

    • Centrifuge to remove debris and extract RNA using commercial kits optimized for viral RNA

  • Molecular detection:

    • Implement real-time RT-PCR targeting conserved regions of the SINV genome as an initial screening method

    • Use nested RT-PCR for increased sensitivity when viral loads are expected to be low

    • Perform conventional RT-PCR with primers targeting structural polyprotein genes for subsequent sequencing

  • Virus isolation:

    • Inoculate PCR-positive samples onto Vero cells and observe for cytopathic effect (CPE)

    • Confirm viral growth by RT-PCR of cell culture supernatant

    • Passage isolates 3-5 times to increase viral titer for further characterization

  • Characterization methods:

    • Perform complete or partial genome sequencing, focusing on the structural polyprotein region

    • Conduct phylogenetic analysis to determine relatedness to known strains

    • Use electron microscopy to visualize viral particles (typically 65 nm in diameter)

    • Calculate maximum likelihood estimates of mosquito infection rates using specialized software such as PooledInfRate

This integrated approach has successfully identified SINV in various mosquito species including Culex torrentium, Cx. pipiens, and Anopheles maculipennis sensu lato in European surveillance studies .

How can researchers effectively use recombinant Ockelbo structural polyprotein in vaccine development efforts?

When utilizing recombinant Ockelbo structural polyprotein for vaccine development, researchers should consider the following strategic approaches:

  • Antigen design optimization:

    • Express the complete structural polyprotein to maintain all relevant epitopes

    • Create truncated versions containing only the most immunogenic regions

    • Engineer chimeric proteins incorporating protective epitopes from multiple SINV strains to create broadly protective candidates

    • Modify potential arthritogenic epitopes to reduce risk of vaccine-induced joint symptoms

  • Platform selection:

    • Evaluate multiple vaccine platforms including subunit proteins, virus-like particles (VLPs), DNA vaccines, and viral vectors

    • Compare immunogenicity profiles across platforms using standardized assays

    • Assess durability of immune responses with different adjuvant formulations

  • Preclinical evaluation pipeline:

    • Establish correlates of protection in mouse models

    • Verify protection against arthritogenic symptoms in appropriate animal models

    • Determine minimum protective dose through dose-ranging studies

    • Evaluate cross-protection against related alphaviruses

  • Immune response characterization:

    • Measure neutralizing antibody titers using pseudotyped reporter viruses

    • Assess T-cell responses using peptide pools covering the structural proteins

    • Evaluate memory B-cell responses through ELISPOT or flow cytometry

    • Monitor for potential antibody-dependent enhancement effects

  • Challenge studies:

    • Use homologous Ockelbo strain challenge as well as heterologous SINV strains

    • Monitor for breakthrough infections and characterize partial protection phenotypes

    • Evaluate protection against clinical symptoms versus sterilizing immunity

This methodical approach incorporates lessons from previous alphavirus vaccine development efforts while addressing the specific characteristics of the Ockelbo strain.

What experimental approaches can be used to study the interaction between Ockelbo structural polyprotein and the host immune system?

To effectively study interactions between Ockelbo structural polyprotein and the host immune system, researchers should implement multi-dimensional experimental approaches:

  • Innate immune response characterization:

    • Measure type I interferon induction in human and mosquito cell lines using reporter assays

    • Evaluate activation of pattern recognition receptors (PRRs) including RIG-I, MDA5, and TLR3

    • Quantify pro-inflammatory cytokine production using multiplex assays

    • Investigate whether specific regions of the structural polyprotein modulate innate immune signaling

  • Adaptive immune response analysis:

    • Characterize antibody epitopes using peptide arrays and competition binding assays

    • Identify CD4+ and CD8+ T cell epitopes using overlapping peptide libraries and HLA binding prediction

    • Evaluate antibody-dependent cellular cytotoxicity (ADCC) using NK cells and antibodies from convalescent patients

    • Investigate memory B and T cell responses in patients with prior Ockelbo disease

  • Host-pathogen interaction studies:

    • Conduct yeast two-hybrid screens to identify host proteins interacting with viral structural proteins

    • Confirm interactions using co-immunoprecipitation and proximity ligation assays

    • Perform CRISPR screens to identify host factors essential for viral entry and assembly

    • Study the structural basis of host-virus interactions using cryo-EM and X-ray crystallography

  • Human cohort studies:

    • Compare immune profiles of symptomatic versus asymptomatic infections

    • Analyze long-term immunity in patients from endemic regions in Northern Europe

    • Investigate factors associated with chronic arthralgia following infection

    • Examine cross-reactivity with other alphaviruses using patient sera

  • Mouse model experiments:

    • Develop humanized mouse models expressing relevant human receptors

    • Evaluate strain-specific differences in immunopathology

    • Test the impact of pre-existing immunity to other alphaviruses

    • Investigate the role of different immune cell populations using depletion studies

These approaches collectively provide a comprehensive picture of how the Ockelbo structural polyprotein interacts with both innate and adaptive immune systems.

What are the best storage conditions and stability parameters for recombinant Ockelbo structural polyprotein preparations?

For optimal preservation of recombinant Ockelbo structural polyprotein integrity and activity, researchers should implement the following evidence-based storage protocols:

Storage ParameterRecommended ConditionsMonitoring MethodsStability Indicators
Temperature-80°C for long-term; -20°C with 50% glycerol for medium-term; 4°C for up to one week Temperature logging; Freeze-thaw cycle countingSDS-PAGE integrity check
Buffer compositionTris-based buffer with 50% glycerol, pH 7.4-8.0 pH monitoring; Visual inspection for precipitationCircular dichroism for secondary structure
Aliquoting strategySingle-use aliquots to prevent freeze-thaw cycles Inventory trackingActivity assays post-thawing
LyophilizationOption for room temperature storage with appropriate cryoprotectantsKarl Fischer titration for residual moistureReconstitution recovery testing
Additive optionsReducing agents (DTT/βME for -SH groups); Protease inhibitors; Non-ionic detergents for hydrophobic regionsSpectrophotometric assessmentFunctional binding assays

Researchers should validate stability using functionality assays specific to their experimental goals, such as ELISA reactivity with conformation-dependent antibodies or receptor binding assays . Repeated freeze-thaw cycles should be strictly avoided as they significantly compromise structural integrity . For applications requiring extended storage at 4°C, addition of antimicrobial agents may be necessary to prevent contamination.

What analytical methods are most appropriate for assessing the purity and conformational integrity of recombinant Ockelbo structural polyprotein?

To rigorously assess both purity and conformational integrity of recombinant Ockelbo structural polyprotein preparations, researchers should employ a comprehensive analytical workflow:

By implementing this multi-method analytical approach, researchers can obtain comprehensive data on both the purity and structural integrity of their recombinant protein preparations, ensuring reproducible experimental outcomes.

How might structural polyprotein variations contribute to the epidemiological patterns of Sindbis virus in Northern Europe?

The epidemiological patterns of Sindbis virus in Northern Europe show distinct cyclical outbreaks, particularly in Finland, Sweden, and Russia, with notable variations in disease incidence and severity . Future research should investigate how structural polyprotein variations might contribute to these patterns through several key approaches:

  • Temporal surveillance studies should sequence the structural polyprotein genes from SINV isolates collected across multiple outbreak cycles to identify mutations that correlate with increased transmission or virulence. The 2018 Finnish outbreak, which occurred during extremely warm climatic conditions, provides a valuable opportunity to examine whether specific structural protein adaptations may have contributed to increased viral fitness under changing environmental conditions .

  • Vector competence studies should examine how specific amino acid substitutions in the structural polyprotein affect virus-vector interactions across different mosquito species. The detection of SINV in both Culex species and Anopheles maculipennis in Germany suggests potential adaptations enabling efficient transmission by multiple vector genera . Experimental infection studies comparing mosquito infection rates and transmission efficiency with viruses carrying different structural polyprotein variants would provide crucial insights.

  • Host range investigations should determine whether structural polyprotein variations influence avian host preferences or viral replication efficiency in different bird species. Since birds of the orders Passeriformes and Anseriformes are considered main hosts responsible for SINV geographic distribution, comparative studies of structural polyprotein binding to receptors from various bird species could reveal adaptation patterns .

  • Human pathogenicity factors within the structural polyprotein should be identified through comparative analysis of sequences from symptomatic versus asymptomatic cases. The observation that clinical infection in humans is almost exclusively reported from Northern Europe, despite SINV's wider distribution, suggests unique features of these virus populations that may reside in the structural proteins involved in cell entry and host immune interaction .

  • Climate-driven evolution models should be developed to predict how changing environmental conditions might select for specific structural polyprotein variants with altered stability, transmission efficiency, or virulence characteristics. The higher seroprevalence observed in rural areas of Northern Sweden (3.7% in men versus 2.0% in women) could reflect occupational exposure differences that might drive distinct evolutionary pressures .

What approaches should be used to investigate potential cross-protection between Ockelbo strain and other alphaviruses?

Investigating potential cross-protection between the Ockelbo strain and other alphaviruses requires systematic approaches spanning in vitro, in vivo, and human studies:

  • Comparative epitope mapping:

    • Generate epitope libraries spanning the structural polyproteins of Ockelbo virus and related alphaviruses (including other SINV strains, chikungunya virus, Ross River virus)

    • Screen sera from Ockelbo-infected patients against these epitope libraries to identify cross-reactive regions

    • Use bioinformatic approaches to identify conserved T-cell epitopes with predicted binding to common HLA alleles

    • Create structural models to visualize spatial relationships between cross-reactive epitopes

  • Neutralization cross-reactivity assessment:

    • Develop a standardized panel of pseudotyped reporter viruses expressing envelope proteins from diverse alphaviruses

    • Test neutralization capacity of sera from Ockelbo patients or vaccinated animals against this virus panel

    • Quantify neutralization titers and construct cross-neutralization maps to visualize relationships

    • Isolate monoclonal antibodies from Ockelbo patients to define molecular determinants of cross-neutralization

  • Animal challenge studies:

    • Immunize mice with recombinant Ockelbo structural polyprotein using various delivery platforms

    • Challenge with heterologous alphaviruses to assess protection against clinical disease

    • Compare protection against viruses from the same genetic lineage versus more distant relatives

    • Evaluate both sterile immunity and disease-modifying protection endpoints

  • Human epidemiological investigations:

    • Conduct serosurveys in regions with co-circulation of multiple alphaviruses

    • Analyze infection histories to determine if prior Ockelbo infection modifies outcomes of subsequent alphavirus exposures

    • Compare immune profiles of individuals with sequential alphavirus infections versus single infections

    • Assess whether childhood exposure to one alphavirus affects adult susceptibility to others

  • Therapeutic development applications:

    • Identify broadly neutralizing antibodies for potential therapeutic development

    • Evaluate cross-protective vaccine candidates based on conserved structural elements

    • Develop animal models that recapitulate human cross-protection phenomena

    • Design diagnostic tools that can distinguish between cross-reactive versus strain-specific antibody responses

Implementing these research strategies would significantly advance understanding of alphavirus immunological relationships and inform development of broadly protective countermeasures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.