Recombinant Sinorhizobium medicae ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sinorhizobium medicae ATP Synthase Subunit a (atpB)

The Recombinant Sinorhizobium medicae ATP synthase subunit a (atpB) is a recombinant protein derived from the ATP synthase complex of Sinorhizobium medicae, a nitrogen-fixing bacterium symbiotic with legumes. This subunit belongs to the F₀ sector of the ATP synthase, responsible for proton translocation across the membrane, a critical step in ATP synthesis. The recombinant form is produced in heterologous hosts such as E. coli, yeast, or mammalian cells, with >85% purity confirmed via SDS-PAGE .

Gene and Protein Attributes

AttributeDescriptionSource
Gene NameatpB (Smed_0447)
Protein LengthFull-length (1–250 amino acids)
Host OrganismsE. coli, yeast, mammalian cells
Purity≥85% (SDS-PAGE)
TagN-terminal His-tag (in some variants)

The subunit a (atpB) forms part of the F₀ subcomplex, which includes subunits a, b, c, and others. In Sinorhizobium medicae, this subunit contributes to proton translocation through its interaction with the c-ring rotor and subunit b .

Proton Translocation and ATP Synthesis

  • Subunit a facilitates proton translocation by coordinating with the c-ring (subunit c) and subunit b in the F₀ sector. This process drives the rotation of the ATP synthase rotor, enabling ATP synthesis .

  • Structural studies in Bacillus PS3 ATP synthase reveal that subunit a’s architecture compensates for the absence of additional subunits in mitochondrial F₀ regions, ensuring efficient proton channeling .

Symbiotic Expression Patterns

Proteomic analyses of S. medicae in free-living vs. symbiotic (bacteroid) states show:

  • Free-Living Cells: ATP synthase subunits, including atpB, are expressed at baseline levels to support cellular energy needs.

  • Bacteroids: Enhanced expression of ATP synthase components (e.g., subunits a, b, c) correlates with increased tricarboxylic acid (TCA) cycle activity, indicating a shift toward meeting symbiotic energy demands .

Comparative Analysis with Other ATP Synthase Subunits

SubunitRole in ATP SynthaseKey FeaturesSource
a (atpB)Proton translocationForms proton channel; interacts with c-ring
b (atpF)Stator componentLinks F₀ to F₁ sectors; stabilizes complex
cRotor componentForms c-ring; drives rotation
δ (atpH)Regulatory subunitModulates ATP synthesis/hydrolysis

Subunit a (atpB) distinguishes itself by its direct involvement in proton translocation, unlike regulatory subunits (e.g., δ) or structural stators (e.g., b) .

Symbiotic Efficiency Studies

  • Nitrogen Fixation: Enhanced ATP synthase activity in bacteroids (including atpB) supports nitrogen fixation by powering nitrogenase via proton motive force .

  • Comparative Genomics: S. medicae WSM419 and S. meliloti WSM1022 exhibit high symbiotic efficiency, partly attributed to optimized ATP synthase subunit expression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms are stable for 6 months at -20°C/-80°C, while lyophilized forms are stable for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
atpB; Smed_0447; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Sinorhizobium medicae (strain WSM419) (Ensifer medicae)
Target Names
atpB
Target Protein Sequence
MSNDPTHQFLVNKIVSIDIGGIDFSFTNASLFMVATVGAAAGFLYLTTSQRGLIPTRMQS VSEMSYEFIASMLREGAGSQGMKFFPMVFSLFMFILTANLLGMVPYFFTVTSQIIVTFAL AVFVIGTVILYGFYKHGFGFLKLFVPHGVPGALLPLVVAIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVASLSAFGALGIGGAILPLIMTVALTGLEFLVAFLQAYVFAVLTCMY LNDAVHPGSH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ATP synthase subunit a (atpB) in Sinorhizobium medicae?

ATP synthase subunit a (atpB) in S. medicae forms a critical component of the membrane-embedded F0 region of the ATP synthase complex. Based on structural studies of bacterial ATP synthases, subunit a contains multiple transmembrane α-helices that form the stationary part of the proton channel . This subunit works in conjunction with the rotating c-ring to convert the energy of proton flow across the membrane into mechanical rotation.

The proton translocation pathway includes key charged residues within subunit a that are essential for function. For example, in bacterial ATP synthases like that of Bacillus PS3, a conserved arginine residue (R169) in subunit a is crucial for enzyme activity, with mutation to alanine resulting in an inactive enzyme .

In S. medicae's symbiotic relationship with legume hosts, ATP synthase activity is particularly relevant as the bacterium requires efficient energy production to support nitrogen fixation, a highly ATP-demanding process that contributes to the bacterium's ability to promote plant growth.

How does ATP synthase structure compare between different bacterial species?

While specific structural data for S. medicae ATP synthase is not provided in the available literature, comparative insights can be drawn from well-characterized bacterial ATP synthases such as that from Bacillus PS3 . In this thermophilic bacterium, cryo-EM studies have revealed atomic models in three rotational states, showing how subunit ε inhibits ATP hydrolysis while allowing ATP synthesis .

Significant species-specific differences exist in regulatory mechanisms. For instance, in Bacillus PS3, inhibition by subunit ε is dependent on ATP concentration, with low ATP concentrations promoting an inhibitory "up" conformation and high concentrations inducing a permissive "down" conformation . In contrast, E. coli ATP synthase inhibition by subunit ε persists even at high ATP concentrations . These differences highlight how ATP synthases from different bacterial species have evolved distinct regulatory mechanisms.

How is ATP synthase activity related to the symbiotic effectiveness of Sinorhizobium medicae?

The symbiotic relationship between S. medicae and legume hosts requires efficient energy metabolism to support both bacterial survival and nitrogen fixation. While the search results don't directly address ATP synthase's role in symbiosis, parallels can be drawn from studies of other S. medicae genes that impact symbiotic effectiveness.

S. medicae WSM419 forms a more effective symbiosis with Medicago truncatula A17 compared to S. meliloti Rm1021, supporting more vigorous plant growth . This effectiveness difference has been attributed to specific genes, including Smed_3503 (renamed iseA), Smed_5985, and Smed_6456, which when expressed in S. meliloti significantly increased plant biomass (by approximately 61%, 24%, and 35%, respectively) .

The following table illustrates how expression of these genes affects nodulation in S. meliloti:

Combination of genesPink nodules (avg)White nodules (avg)Pink nodules (SEM)White nodules (SEM)
Vector control17.98.41.61.0
pCPP30-iseA28.7***5.31.80.5
pSRKGm-iseA27.5***5.71.90.8
pCPP30-iseA + pSRKGm-iseA30.1***6.31.60.7
pCPP30-Smed_598525.4**5.91.71.1

By analogy, the efficient functioning of ATP synthase would be expected to contribute significantly to symbiotic effectiveness, as it provides the energy required for nitrogen fixation. Modifications to atpB that enhance ATP synthesis efficiency might similarly improve symbiotic performance.

What expression systems are optimal for producing functional recombinant S. medicae atpB?

Based on successful expression of other bacterial ATP synthases, several systems can be considered for S. medicae atpB expression:

E. coli expression system: The Bacillus PS3 ATP synthase was successfully expressed in E. coli, purified, and analyzed by cryo-EM . This suggests E. coli could serve as a viable host for S. medicae atpB expression. When using E. coli, consider:

  • Strains optimized for membrane protein expression

  • Induction conditions that balance expression level and proper folding

  • Fusion tags to facilitate purification and enhance solubility

Homologous expression in Sinorhizobium: The search results describe successful cloning of S. medicae genes into S. meliloti using the E. coli lacZ promoter, which is considered relatively strong in Sinorhizobium . This approach offers the advantage of a native-like membrane environment that may promote proper folding and assembly.

For both systems, expression vectors like pCPP30 (Tc^r) or pSRKGm (Gm^r) have been successfully used for expressing S. medicae genes in S. meliloti , suggesting their potential utility for atpB expression.

When expressing membrane proteins like atpB, it's crucial to verify proper folding and membrane integration. Improperly folded membrane proteins often aggregate or display significantly reduced activity. Therefore, functional assays should accompany expression studies to confirm the recombinant protein's activity.

How do mutations in conserved residues of atpB affect proton translocation?

In bacterial ATP synthases, several conserved residues in subunit a are critical for proton translocation. Based on structural studies of the Bacillus PS3 ATP synthase, a conserved arginine residue (R169) in subunit a is essential for enzyme activity, with mutation to alanine resulting in an inactive enzyme .

This arginine residue is thought to play a crucial role in the proton transfer pathway, likely participating in charge interactions that facilitate proton movement through the membrane. The precise arrangement of transmembrane α-helices in subunit a creates the architecture necessary for directional proton translocation coupled to c-ring rotation.

For S. medicae atpB, researchers should consider:

  • Identifying conserved charged residues through sequence alignment with well-characterized bacterial ATP synthases

  • Creating site-directed mutations of these residues

  • Assessing the effects on both ATP synthesis and proton translocation activities

  • Correlating functional changes with predicted structural alterations

The interaction between subunit a and neighboring subunits also influences proton translocation. In the Bacillus PS3 ATP synthase, the single N-terminal membrane-embedded α-helix in each copy of subunit b forms different interactions with subunit a . One interacts with transmembrane α-helices 1, 2, 3, and 4 of subunit a, while the other interacts with α-helices 5 and 6 and the loop between α-helices 3 and 4 . These interactions may stabilize the proton channel structure.

How does the regulatory mechanism of ATP synthase differ between S. medicae and other bacterial species?

ATP synthase regulation shows significant species-specific variations, particularly in mechanisms preventing wasteful ATP hydrolysis. In Bacillus PS3, subunit ε adopts an "up" conformation that inhibits ATP hydrolysis, with this inhibition being dependent on ATP concentration . Low ATP concentrations (<0.7 mM) promote the inhibitory conformation, while high concentrations (>1 mM) induce a permissive "down" conformation .

In contrast, E. coli ATP synthase inhibition by subunit ε persists even at high ATP concentrations in the absence of a sufficient proton motive force . This difference is attributed to structural variations in subunit ε. In E. coli, the second α-helix of subunit ε has an offset created by a 10-residue loop that allows interaction with subunit γ, potentially stabilizing the inhibitory "up" conformation .

The structural details of Bacillus PS3 ATP synthase suggest that subunit ε in the "up" conformation selectively blocks ATP hydrolysis while still allowing ATP synthesis . The cryo-EM maps show that a clash between subunit ε and subunit β prevents the central rotor from turning in the direction of ATP hydrolysis while allowing rotation in the direction of ATP synthesis .

Although specific regulatory mechanisms for S. medicae ATP synthase are not detailed in the search results, the variations observed between Bacillus PS3 and E. coli highlight the evolutionary diversity in ATP synthase regulation that likely extends to S. medicae, potentially reflecting adaptations to its symbiotic lifestyle.

What are effective approaches for purifying recombinant bacterial ATP synthase complexes?

Purification of bacterial ATP synthase complexes requires specialized approaches due to their membrane-embedded nature. The successful purification of Bacillus PS3 ATP synthase for cryo-EM analysis provides a model approach that can be adapted for S. medicae ATP synthase:

  • Expression strategy: Express the complete ATP synthase complex rather than individual subunits to maintain proper assembly and interactions. Consider using the E. coli expression system, which was successful for Bacillus PS3 ATP synthase .

  • Membrane solubilization: Select appropriate detergents that efficiently extract the complex while preserving structural integrity. Common options include:

    • DDM (n-dodecyl-β-D-maltopyranoside) - A mild detergent widely used for membrane protein purification

    • Digitonin - Very gentle, often preserves protein-protein interactions

    • LMNG - Provides high stability for membrane protein complexes

  • Purification workflow:

    • Affinity chromatography using tags added to specific subunits

    • Size exclusion chromatography to separate the intact complex from aggregates and partial complexes

    • Optional ion exchange chromatography for further purification

  • Quality assessment:

    • Blue native PAGE to verify complex integrity

    • Activity assays to confirm functional preservation

    • Negative stain EM to check sample homogeneity before proceeding to cryo-EM

For S. medicae ATP synthase specifically, researchers might need to optimize detergent and buffer conditions to account for potential differences in stability compared to thermophilic Bacillus PS3 ATP synthase.

How can cryo-EM be effectively used to determine ATP synthase structure?

Cryo-EM has emerged as a powerful technique for determining the structure of ATP synthases, as demonstrated by the successful structural analysis of Bacillus PS3 ATP synthase . For S. medicae ATP synthase, a similar approach could be implemented:

  • Sample preparation optimization:

    • Ensure biochemical homogeneity through rigorous purification

    • Test different detergents or consider nanodiscs for membrane protein stabilization

    • Optimize protein concentration for ideal particle distribution on grids

  • Data collection strategy:

    • Collect data across multiple defocus values

    • Implement motion correction protocols

    • Consider collecting tilt series if preferential orientation is observed

    • Collect sufficient images to achieve high resolution (typically hundreds of thousands of particles)

  • Image processing workflow:

    • Classify particles to identify different conformational states, as observed with the three rotational states in Bacillus PS3 ATP synthase

    • Apply appropriate masking strategies to deal with flexibility differences between F1 and F0 regions

    • Consider focused refinement approaches for regions showing lower resolution

The cryo-EM analysis of Bacillus PS3 ATP synthase revealed several important features, including how subunit ε inhibits ATP hydrolysis while allowing ATP synthesis, and the architecture of the membrane region showing how simple bacterial ATP synthases perform the same core functions as more complex mitochondrial enzymes . Similar insights could be gained for S. medicae ATP synthase.

The membrane region (F0) often shows lower quality in cryo-EM maps compared to the rest of the complex, as observed in E. coli ATP synthase structures (6-7 Å resolution) . This challenge should be anticipated and addressed through optimized data collection and processing strategies.

What functional assays can validate recombinant atpB activity?

Functional validation of recombinant atpB requires assays that can measure both ATP synthesis and proton translocation. The following approaches are recommended:

  • ATP synthesis assays:

    • Reconstitute purified ATP synthase (including atpB) into liposomes

    • Generate a proton gradient using acid-base transition or ionophores

    • Measure ATP production using luciferase-based assays

  • ATP hydrolysis assays:

    • Measure inorganic phosphate release using colorimetric assays

    • Monitor ATPase activity under various conditions to assess regulatory mechanisms

    • Test inhibition patterns that might differ between species (e.g., subunit ε-mediated inhibition that is ATP-concentration dependent in Bacillus PS3 but not in E. coli)

  • Proton pumping assays:

    • Monitor pH changes using pH-sensitive fluorescent dyes

    • Measure proton translocation in reconstituted systems

  • Structural integrity assessments:

    • Use crosslinking approaches to verify interaction with other subunits

    • Perform limited proteolysis to assess proper folding

    • Apply negative stain EM to visualize complex formation

When validating recombinant atpB function, it's important to consider the regulatory differences observed between bacterial species. For example, the ATP-dependent inhibition by subunit ε observed in Bacillus PS3 but not in E. coli highlights the need to assess regulatory properties specifically relevant to S. medicae.

How should researchers interpret differences in ATP synthase activity between wild-type and mutant atpB variants?

When analyzing differences in ATP synthase activity between wild-type and mutant atpB variants, researchers should consider multiple factors that influence interpretation:

  • Expression and assembly differences:

    • Verify that mutant proteins are expressed at similar levels to wild-type

    • Confirm proper integration into the membrane and assembly with other subunits

    • Assess protein stability under experimental conditions

  • Functional impact assessment:

    • Compare both ATP synthesis and ATP hydrolysis activities

    • Evaluate proton translocation efficiency

    • Assess the effect on regulatory mechanisms, such as inhibition by subunit ε

  • Structure-function correlations:

    • Relate activity changes to the predicted structural alterations

    • Consider the location of mutations relative to known functional sites

    • Reference analogous mutations in other bacterial species where structural data exists

  • Physiological relevance:

    • For S. medicae, consider how changes in ATP synthase activity might affect symbiotic performance

    • Evaluate whether mutations affect adaptation to conditions encountered during nodule formation

The interpretation of mutation effects should be informed by structural knowledge. For example, in Bacillus PS3 ATP synthase, mutation of a conserved arginine (R169A) in subunit a leads to an inactive enzyme . This information helps interpret similar mutations in S. medicae atpB, particularly those affecting conserved residues in the proton channel.

What approaches can assess the impact of atpB modifications on symbiotic effectiveness?

To evaluate how atpB modifications affect S. medicae's symbiotic effectiveness with legume hosts, researchers can adapt the methodologies used to assess other S. medicae genes that impact symbiosis :

  • Plant growth parameters:

    • Measure plant biomass under controlled conditions

    • Assess other growth indicators (height, leaf area, chlorophyll content)

    • Compare with positive controls (wild-type S. medicae) and negative controls (non-inoculated plants)

  • Nodulation assessment:

    • Count and classify nodules (pink/functional vs. white/ineffective)

    • Measure nodulation timing and development

    • Use statistical analysis to determine significance, as demonstrated in the nodulation data for iseA and other genes

  • Nitrogen fixation measurement:

    • Perform acetylene reduction assays to quantify nitrogenase activity

    • Measure plant nitrogen content as an indicator of effective nitrogen fixation

    • Assess bacterial persistence in nodules over time

  • Correlation analysis:

    • Relate ATP synthase activity levels to symbiotic parameters

    • Develop models that predict how energy metabolism affects symbiotic performance

The study of S. medicae genes that improve symbiosis provides a methodological framework, showing how introducing genes like iseA into S. meliloti increased M. truncatula biomass by 61% . A similar experimental design could evaluate how atpB modifications affect symbiotic outcomes.

Split-root experiments, as performed with iseA , could also be valuable for determining whether atpB modifications affect plant-induced resistance to rhizobial infection, providing insights into how energy metabolism influences host-microbe signaling.

How might advances in structural biology techniques enhance our understanding of S. medicae ATP synthase?

Recent advances in structural biology techniques, particularly cryo-EM, have revolutionized our understanding of ATP synthases. The successful determination of Bacillus PS3 ATP synthase structure in three rotational states demonstrates the potential for similar analyses of S. medicae ATP synthase.

Future research could benefit from:

  • High-resolution cryo-EM analysis: Determine the structure of S. medicae ATP synthase in multiple conformational states to understand species-specific features and regulatory mechanisms.

  • Time-resolved cryo-EM: Capture intermediate states during the ATP synthesis cycle to elucidate the dynamic aspects of the enzyme's function.

  • In situ structural studies: Develop approaches to study ATP synthase structure within bacterial cells or bacteroids in nodules to understand its native environment.

  • Integrative structural biology: Combine cryo-EM with complementary techniques like mass spectrometry, molecular dynamics simulations, and functional assays to build a comprehensive model of ATP synthase function in S. medicae.

These approaches would help address key questions about S. medicae ATP synthase, such as:

  • How does its structure compare to that of other bacterial ATP synthases?

  • What structural features enable adaptation to the symbiotic lifestyle?

  • How do regulatory mechanisms modulate ATP synthase activity during different stages of symbiosis?

What potential applications exist for engineered S. medicae ATP synthase variants?

Engineered variants of S. medicae ATP synthase could have several research and agricultural applications:

  • Enhanced symbiotic nitrogen fixation:

    • Optimizing ATP synthase efficiency could improve energy availability for nitrogen fixation

    • Enhanced energy metabolism might improve bacterial survival under stress conditions in the rhizosphere

    • Modifications that increase symbiotic effectiveness could lead to improved plant growth, similar to the effects observed with iseA, which increased M. truncatula biomass by 61%

  • Research tools:

    • ATP synthase variants could serve as models for understanding energy metabolism in symbiotic bacteria

    • Engineered ATP synthases could help elucidate the relationship between energy production and symbiotic effectiveness

    • Tagged variants could facilitate studies of protein localization and dynamics during symbiosis

  • Agricultural applications:

    • Improved S. medicae strains with optimized ATP synthase could enhance sustainable agriculture practices

    • Enhanced nitrogen fixation efficiency could reduce dependency on chemical fertilizers

    • Strains adapted to specific environmental conditions could extend the range of sustainable legume cultivation

These applications build on the observed improvements in symbiotic effectiveness achieved by introducing specific S. medicae genes into S. meliloti , suggesting that targeted modifications of energy metabolism could similarly enhance symbiotic performance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.