Recombinant Sinorhizobium medicae ATP synthase subunit b/b' (atpG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; Smed_0449; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Sinorhizobium medicae (strain WSM419) (Ensifer medicae)
Target Names
atpF2
Target Protein Sequence
MFVTAAYAQSTTTEGAEAHDAAAAGEVHTETGVAHEGEHGSGVFPPFDSTHFASQLLWLA ITFGLFYLLMSKVIIPRIGSILETRHDRIAQDLDEASRLKGEADAAIAAYEQELAGARAK GHSIADTAREAAKSKAKADRDGVEADLAKKIAAAEARIGDIKSKALADVGAIAEETATAI VKQLIGGTVTKSEIAAAFKASAGN
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembraneous catalytic F1 domain and the membrane-embedded proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. The b' subunit, a divergent duplicate of the b subunit found in plants and photosynthetic bacteria, is a component of the F0 channel and part of the peripheral stalk, linking F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does atpG differ structurally and functionally from atpF in Sinorhizobium medicae?

Both atpG and atpF are subunits of the F0 sector of ATP synthase but differ in their sequences and specific roles:

  • atpF (Subunit b): 161 amino acids in length, encoded by the Smed_0450 locus in S. medicae WSM419. Functions as part of the peripheral stalk connecting F0 and F1 sectors .

  • atpG (Subunit b/b'): 204 amino acids, encoded by the Smed_0449 locus. Works together with atpF in the stator complex of ATP synthase .

The two proteins show distinct hydrophobic regions and membrane-spanning domains, but both contribute to maintaining the structural integrity of the ATP synthase complex during catalytic rotation.

What are the optimal expression systems for producing recombinant Sinorhizobium medicae atpG?

Based on established protocols for bacterial membrane proteins, the following expression systems have proven effective:

  • E. coli BL21(DE3) system: Using pET vectors with T7 promoter control for high-level expression. Transformation and culture protocols similar to those used for S. meliloti membrane proteins are recommended .

  • Yeast expression systems: While not specifically documented for S. medicae atpG, yeast expression systems similar to those used for human ATP synthase components can be adapted. These systems are particularly valuable when proper folding is challenging in bacterial hosts .

For optimal results:

  • Use low induction temperatures (16-20°C)

  • Include membrane-stabilizing agents in the growth medium

  • Consider fusion tags that enhance solubility (MBP, SUMO)

What purification strategies yield the highest purity recombinant atpG protein?

A multi-step purification protocol is recommended:

  • Membrane isolation: Differential centrifugation followed by sucrose gradient separation

  • Solubilization: Using mild detergents (DDM, LDAO, or C12E8)

  • Affinity chromatography: Utilizing His-tagged constructs with Ni-NTA resin

  • Size exclusion chromatography: For final purification and buffer exchange

This approach typically yields protein with >90% purity as determined by SDS-PAGE, similar to purification methods used for related proteins .

How does atpG contribute to ATP synthase activity in Sinorhizobium medicae?

The atpG subunit plays critical roles in:

  • Structural support: Forms part of the stator complex that prevents rotation of the F1 catalytic domain during ATP synthesis

  • Energy coupling: Helps transmit conformational changes between the F0 proton channel and F1 catalytic domain

  • Complex stability: Maintains proper alignment of rotary and stationary components

In S. medicae, like other bacteria, the proton motive force (pmf) drives rotation of the c-ring, which transmits torque to the F1 catalytic head where ATP synthesis occurs. Subunit atpG is essential for this energy transduction process, working with subunit a to provide the structural framework for proton translocation .

What experimental approaches can measure atpG-dependent ATP synthesis activity?

Several complementary approaches can be used:

  • Inverted membrane vesicles assay: Measures ATP synthesis rates in membrane preparations containing ATP synthase

    • Protocol: Preparation of vesicles through French press or sonication, followed by measurement of ATP formation using luciferin-luciferase assay

  • Reconstitution in liposomes: Purified ATP synthase complex containing atpG is reconstituted in artificial liposomes

    • Data can be analyzed for:

      • Proton pumping efficiency

      • ATP synthesis rates

      • Effects of pH and membrane potential

  • Whole-cell bioenergetics: Oxygen consumption and membrane potential measurements in intact cells

    • Similar to methods used for S. meliloti ATP synthase functional analysis , where TiO2 enrichment and LC-MS/MS have been employed to study the phosphoproteome

How does atpG expression change during symbiotic interactions with legume hosts?

During symbiosis, S. medicae adjusts its metabolism to adapt to the microaerobic conditions within root nodules. Studies suggest:

  • Expression patterns: atpG expression likely increases during early nodule formation when energy demands are high for bacterial proliferation

  • Regulation mechanisms: Similar to other ATP synthase subunits, atpG expression may be:

    • Upregulated in response to carbon availability from the plant host

    • Downregulated under extreme microaerobic conditions when oxidative phosphorylation becomes limited

    • Fine-tuned by regulatory proteins that sense oxygen levels

  • Comparative nodule proteomics: While not specifically focused on atpG, comparative proteomics of S. medicae WSM419 in free-living and symbiotic states has revealed numerous proteins that show differential abundance between these conditions .

What evidence connects ATP synthase activity to nodulation efficiency in Sinorhizobium-legume interactions?

Several lines of evidence suggest ATP synthase activity impacts symbiotic effectiveness:

  • Energy requirements for nodulation: The process of nodule formation and nitrogen fixation has high energy demands, requiring efficient ATP synthesis

  • Plant growth correlation: Though not specifically linked to atpG, certain S. medicae genes have been shown to increase nodulation and improve plant growth, highlighting the importance of metabolic optimization in symbiosis

  • Comparative studies: S. medicae WSM419 forms more effective symbiosis with Medicago truncatula A17 than S. meliloti Rm1021, which may partly relate to differences in energy metabolism efficiency

What methods are effective for generating site-directed mutations in the atpG gene?

Several established molecular techniques can be adapted for atpG mutagenesis:

  • CRISPR-Cas9 approach: For precise genome editing

    • Design of guide RNAs targeting atpG

    • Introduction of repair templates containing desired mutations

How can the phenotypic effects of atpG mutations be assessed in symbiotic relationships?

A comprehensive phenotypic assessment includes:

  • Nodulation assays:

    • Plant inoculation experiments similar to those described for testing other S. medicae genes

    • Quantification of nodule number, size, and morphology

    • Assessment of nitrogen fixation efficiency using acetylene reduction assay

  • Plant growth parameters:

    • Measurement of shoot and root dry weight

    • Comparison to plants inoculated with wild-type strains

    • Statistical analysis to evaluate significant differences

  • Microscopic analysis:

    • Electron microscopy to examine bacteroid development

    • Confocal microscopy with fluorescently tagged bacteria to monitor infection and colonization

  • Complementation studies:

    • Introduction of wild-type atpG gene to confirm phenotypes are due to the mutation

    • Expression under native or constitutive promoters

These approaches mirror methods used to assess the effects of other S. medicae genes on symbiosis .

What structural techniques are most informative for studying recombinant atpG protein interactions?

Several complementary techniques provide valuable structural insights:

  • X-ray crystallography: For high-resolution structural determination

    • Requires highly pure, homogeneous protein preparations

    • May need to co-crystallize with binding partners or stabilizing factors

  • Cryo-electron microscopy: Increasingly powerful for membrane protein complexes

    • Allows visualization of atpG in the context of the complete ATP synthase complex

    • Can reveal dynamic states and conformational changes

  • Cross-linking mass spectrometry:

    • Identifies interaction interfaces between atpG and other ATP synthase subunits

    • Protocol involves:

      • Chemical cross-linking of purified complex

      • Enzymatic digestion

      • LC-MS/MS analysis of cross-linked peptides

  • Hydrogen-deuterium exchange mass spectrometry:

    • Maps solvent-accessible regions and conformational dynamics

    • Particularly useful for detecting structural changes under different conditions

How does the structure of S. medicae atpG compare to homologous proteins in other bacterial species?

Comparative analysis reveals both conservation and specialization:

  • Sequence conservation:

    • Core functional domains show high conservation across alphaproteobacteria

    • Terminal regions often display greater variability, potentially reflecting adaptation to specific niches

  • Structural features:

    • Analysis suggests S. medicae atpG maintains the characteristic alpha-helical structure found in ATP synthase b subunits

    • Species-specific features may relate to optimal function in the soil and symbiotic environments inhabited by S. medicae

  • Evolutionary adaptations:

    • S. medicae-specific features might reflect adaptation to:

      • pH conditions in soil and nodule environments

      • Energy requirements during symbiosis

      • Interaction with other Sinorhizobium-specific proteins

What post-translational modifications have been identified in Sinorhizobium ATP synthase subunits?

While specific data for atpG in S. medicae is limited, studies on related rhizobia provide insights:

How do post-translational modifications affect ATP synthase function during symbiosis?

Post-translational modifications likely serve as regulatory mechanisms:

How can recombinant atpG be used as a tool for studying bacterial bioenergetics?

Recombinant atpG offers several research applications:

  • Structure-function analysis:

    • Creation of chimeric proteins with regions from different bacterial species

    • Systematic mutagenesis to identify critical functional residues

  • Reporter systems:

    • Development of atpG-fusion proteins for monitoring ATP synthase assembly

    • Creation of sensors for proton motive force or membrane potential

  • Protein-protein interaction studies:

    • Identification of interaction partners beyond the ATP synthase complex

    • Screening for small molecules that modulate these interactions

What methods can detect interactions between atpG and other proteins in the ATP synthase complex?

Several complementary approaches provide robust interaction data:

  • Co-immunoprecipitation:

    • Using antibodies against tagged atpG to pull down interaction partners

    • Mass spectrometry analysis of co-precipitated proteins

  • Bacterial two-hybrid systems:

    • Adapted for membrane proteins to detect direct interactions

    • Can be used to screen for interaction-disrupting mutations

  • FRET-based approaches:

    • Tagging atpG and potential partners with fluorescent proteins

    • Measuring energy transfer as indication of proximity

  • Surface plasmon resonance:

    • For quantitative measurement of binding kinetics

    • Requires purified components and careful membrane protein handling

These methods can be combined with genetic approaches similar to those used for studying S. meliloti protein interactions .

How conserved is atpG across Sinorhizobium species and other rhizobia?

Genomic analyses reveal evolutionary patterns of conservation and specialization:

  • Conservation within Sinorhizobium:

    • The atpG gene shows high conservation within the S. medicae species

    • All 31 sequenced S. medicae strains in the Joint Genome Institutes database contain homologous atpG genes

    • This conservation suggests essential function for this subunit

  • Cross-species comparison:

    • Moderate sequence divergence between S. medicae and S. meliloti atpG

    • Greater divergence when compared to more distant rhizobia

    • Conserved functional domains with variable regions that may relate to species-specific adaptations

  • Evolutionary implications:

    • Core ATP synthase machinery is ancient and highly conserved

    • Species-specific variations may reflect adaptation to particular hosts or environmental niches

What genetic diversity exists in atpG across natural populations of S. medicae?

Population genomics studies provide insights into natural variation:

  • Nucleotide polymorphism patterns:

    • Based on studies of other S. medicae genes, the chromosome generally shows low sequence polymorphism compared to plasmids

    • Essential genes like those encoding ATP synthase components typically show lower polymorphism rates

  • Geographic variation:

    • S. medicae populations from different soil types and geographic regions may harbor distinct atpG variants

    • These variations potentially reflect adaptation to local environmental conditions

  • Host-associated selection:

    • S. medicae strains isolated from different Medicago species may show specific adaptations in metabolic genes

    • This diversity relates to optimization for particular symbiotic relationships

What are promising research areas regarding S. medicae atpG and symbiotic efficiency?

Several research avenues warrant further investigation:

  • Metabolic engineering applications:

    • Modification of atpG to enhance ATP production during symbiosis

    • Potential to improve nitrogen fixation efficiency and plant growth

  • Integration with symbiotic signaling:

    • Investigation of how energy production via ATP synthase is coordinated with nodulation signals

    • Potential regulatory connections between ATP status and symbiotic gene expression

  • Environmental adaptation:

    • Study of how atpG function adapts to diverse soil conditions (pH, temperature, salinity)

    • Implications for expanding the range of effective symbiosis

What emerging technologies could advance understanding of atpG function?

Novel methodologies offer new research possibilities:

These approaches could build upon and extend current understanding of S. medicae symbiosis genes and their roles in plant interactions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.