Recombinant Sinorhizobium medicae Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Functional Classification and Enzymatic Activity

Cobalamin synthase (CobS) functions as an adenosylcobinamide-GDP ribazoletransferase (EC 2.-.-.-), catalyzing a crucial step in the aerobic cobalamin biosynthetic pathway . This enzyme is specifically involved in the final stages of vitamin B12 synthesis, where it facilitates the attachment of the lower ligand to form the complete cobalamin molecule.

In biochemical terms, CobS catalyzes the conversion of adenosylcobinamide-GDP to adenosylcobalamin-5'-phosphate by facilitating the replacement of GDP with 5,6-dimethylbenzimidazole (DMB) . This reaction represents one of the terminal steps in cobalamin biosynthesis, making CobS essential for the production of functional B12 molecules.

The enzyme belongs to a larger family of cobalamin biosynthetic enzymes encoded by cob genes that are widely distributed across bacterial species capable of vitamin B12 production. In Sinorhizobium medicae, as in other related rhizobia, the CobS enzyme works in concert with other Cob proteins to complete the aerobic pathway of cobalamin synthesis .

Genomic Context and Phylogenetic Relationships

The cobS gene in Sinorhizobium medicae is part of a larger cobalamin biosynthetic gene cluster. Comparative genomic analysis reveals that S. medicae possesses a complement of 22 cobalamin biosynthetic genes (cob genes), similar to the arrangement found in other Sinorhizobium/Ensifer species . This arrangement of genes suggests a conserved function across related bacterial species.

Phylogenetic analysis of cob genes, particularly cobN (the longest of the cob genes at approximately 3,800-4,000 bp), demonstrates that the evolutionary history of these genes generally reflects bacterial taxonomy. The cobS gene and its protein product in Sinorhizobium medicae show high sequence similarity to those found in other members of the Rhizobiaceae family .

Studies of related species like Ensifer adhaerens CSBa (a cobalamin producer) have revealed that the cob gene arrangement in these bacteria is similar to that of other Ensifer species and most similar to that of Pseudomonas denitrificans SC510. This genomic organization plays a significant role in the functional capabilities of the CobS enzyme .

Role in Bacterial Symbiosis and Nitrogen Fixation

Cobalamin synthase and the vitamin B12 it helps produce play crucial roles in the symbiotic relationship between Sinorhizobium species and leguminous plants. Research focusing on the closely related S. meliloti has demonstrated that cobalamin is essential for establishing productive symbiotic relationships with host plants such as alfalfa (Medicago sativa) .

The importance of cobalamin in symbiosis stems from its role as a cofactor for several critical enzymes. S. meliloti possesses three known cobalamin-dependent enzymes:

  1. Methylmalonyl CoA mutase (BhbA)

  2. Methionine synthase (MetH)

  3. Ribonucleotide reductase (NrdJ)

Of these, the ribonucleotide reductase appears to be particularly critical for successful symbiosis. Experiments with S. meliloti engineered to express a cobalamin-independent ribonucleotide reductase instead of NrdJ showed severe defects in symbiosis. These bacteria could penetrate alfalfa nodules but were unable to differentiate into nitrogen-fixing bacteroids and were subsequently lysed in the plant cytoplasm .

The critical nature of cobalamin for the survival of Sinorhizobium in its plant host explains why these bacteria dedicate considerable resources to cobalamin biosynthesis, including the maintenance and expression of the cobS gene .

Comparative Analysis with Related Species

The CobS protein from Sinorhizobium medicae shares significant structural and functional similarities with homologous proteins from related bacterial species. Table 2 presents a comparison of S. medicae CobS with its counterpart in Rhizobium leguminosarum bv. viciae.

Table 2: Comparison of CobS Proteins from Different Rhizobial Species

FeatureS. medicae CobSR. leguminosarum bv. viciae CobS
Length262 amino acids260 amino acids
UniProt IDA6U9W5Q1MFK3
Expression SourceE. coliE. coli
FunctionCobalamin-5'-phosphate synthaseCobalamin-5'-phosphate synthase
TagHis (N-terminal)His (N-terminal)

Interestingly, research on Ensifer adhaerens CSBa (a related cobalamin producer) has revealed that its cob genes show remarkable similarity to those of Pseudomonas denitrificans SC510, with sequence similarities ranging from 96.6% to 99.8% . This high degree of similarity suggests potential lateral gene transfer events in the evolutionary history of these cobalamin biosynthesis genes.

Biosynthetic Pathway Context

CobS functions within the complex aerobic pathway of cobalamin biosynthesis. In Sinorhizobium and related bacteria, this pathway involves approximately 30 enzymes and proceeds through multiple intermediate compounds . The final stages of this pathway, where CobS plays its role, involve the assembly of the complete cobalamin molecule.

Research with S. meliloti has provided insights into the terminal steps of cobalamin biosynthesis. The bluB gene in S. meliloti has been shown to be necessary for the production of 5,6-dimethylbenzimidazole (DMB), the lower ligand of cobalamin. Mutations in bluB prevent the synthesis of DMB, resulting in an inability to complete cobalamin synthesis unless DMB is supplied externally .

The condensation of ribosylated DMB with GDP-cobinamide represents the final step in the biosynthetic pathway, and CobS is directly involved in this process. In the absence of functional CobS, bacteria cannot complete this crucial step, leading to deficiencies in cobalamin production .

Studies of S. meliloti mutants have shown that when cobalamin synthesis is interrupted, bacterial growth in minimal media is severely impaired, and the establishment of symbiosis with host plants fails. These defects can be rescued by the addition of cyanocobalamin or DMB, highlighting the critical nature of the reaction catalyzed by CobS .

Research Applications and Significance

Recombinant Sinorhizobium medicae CobS protein has significant applications in research focused on:

  1. Understanding cobalamin biosynthesis mechanisms

  2. Investigating bacterial adaptation to different environments

  3. Developing strategies to enhance symbiotic nitrogen fixation

  4. Exploring potential biotechnological applications of rhizobial bacteria

The availability of purified recombinant CobS enables detailed biochemical and structural studies that can illuminate the precise mechanisms of cobalamin synthesis. This knowledge has implications not only for basic microbiology but also for applied fields such as sustainable agriculture.

The critical nature of cobalamin for successful plant-microbe interactions makes CobS and other cobalamin biosynthetic enzymes potential targets for enhancing symbiotic relationships. Manipulating these enzymes could potentially improve nitrogen fixation efficiency, reducing the need for chemical fertilizers in agriculture .

Furthermore, the study of lateral gene transfer events involving cob genes provides insights into bacterial evolution and adaptation. The high sequence similarities observed between distantly related bacteria suggest that cobalamin biosynthesis genes may be subject to horizontal transfer, which has implications for understanding bacterial community dynamics and evolution .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
cobS; Smed_1604; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Sinorhizobium medicae (strain WSM419) (Ensifer medicae)
Target Names
cobS
Target Protein Sequence
MTEIREFWDDVARSVAFLSRIPVPDRHFRGHDGGLGRAVRAFPLAGILIALPAAVTAVLL GAIHASSLFTAFLIVAAQATVTGALHEDGLADTADGFGGGRDRESALEIMKDSRIGTYGA VALILSFGIRVSALAAFLPLLTPTGGGVALLATAALSRAAMVWHWSRLPPARRDGVAAAA GAPEAPATSVALGSGVILALVLFFLSGIPTVAVLLSFGAFVLAVLSFTRIASRKLGGHTG DTIGATQQLTEVAVLGALALAI
Uniprot No.

Target Background

Function

Recombinant Sinorhizobium medicae Cobalamin synthase (CobS) catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sinorhizobium medicae and why is it significant for cobalamin synthase research?

Sinorhizobium medicae is a nitrogen-fixing bacterium that forms symbiotic relationships with legumes, particularly Medicago species. It belongs to the same genus as Sinorhizobium meliloti but displays distinct host specificity patterns . While S. meliloti forms symbiotic relationships with alfalfa and other leguminous plants, S. medicae has been isolated from wild Medicago lupulina plants . Unlike some rhizobial symbionts, Sinorhizobium species generally lack type III secretion machinery, which influences their symbiotic interactions .

The significance of studying cobalamin synthase (CobS) in S. medicae lies in understanding how this essential enzyme contributes to bacterial metabolism and potentially to symbiotic relationships. Cobalamin (vitamin B12) is a complex cobamide cofactor required for various metabolic processes in bacteria. By investigating CobS in S. medicae, researchers can explore species-specific adaptations in cobalamin biosynthesis that may relate to symbiotic efficiency with Medicago hosts.

What is the function of cobalamin synthase (CobS) in bacteria?

Cobalamin synthase (CobS) is an integral membrane protein that catalyzes the penultimate step in the biosynthesis of adenosylcobalamin (vitamin B12) . Specifically, CobS performs the condensation reaction between activated corrin ring and lower ligand base precursors, which represents a critical convergence of two pathways necessary for nucleotide loop assembly in cobalamin biosynthesis .

In bacteria like Salmonella typhimurium, CobS has been experimentally confirmed to possess cobalamin-5'-phosphate synthase activity . It catalyzes the reaction between adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-5'-phosphate to form adenosylcobalamin-5'-phosphate (AdoCbl-5'-P) . This reaction is part of the "late steps" of the adenosylcobalamin biosynthetic pathway, which are responsible for the assembly of the nucleotide loop and are required during both de novo synthesis and precursor salvaging .

The membrane association of CobS is evolutionarily conserved among all cobamide producers, suggesting an important physiological relevance to this localization . CobS likely functions within a multienzyme complex associated with the cell membrane, alongside other enzymes involved in the late steps of cobamide biosynthesis, including CbiB, CobU, CobT, and CobC .

How can recombinant CobS from S. medicae be expressed and purified?

While the search results don't provide specific protocols for S. medicae CobS, we can infer appropriate methods based on successful approaches used for CobS from other bacterial species. Recent advances in purification protocols for membrane proteins like CobS have significantly improved protein yield and purity.

For recombinant expression of S. medicae CobS, researchers typically:

  • Clone the cobS gene from S. medicae genomic DNA into an expression vector with an affinity tag (commonly a His-tag)

  • Transform the construct into an appropriate E. coli expression strain

  • Optimize expression conditions (temperature, inducer concentration, duration)

  • Lyse cells and solubilize membrane proteins using carefully selected detergents

  • Purify using affinity chromatography, followed by additional purification steps if needed

Based on advances with other bacterial CobS proteins, researchers have developed improved protocols that yield highly purified protein. For example, with S. typhimurium CobS, a purification method has been reported that yields 96% homogenous protein as determined by densitometry analysis . Similar approaches could be adapted for S. medicae CobS, with specific optimization for the unique properties of this protein.

What assays can be used to measure CobS activity in vitro?

The activity of recombinant CobS can be measured using several complementary approaches:

  • Radiolabeled substrate assay: Using radiolabeled AdoCbi-GDP and α-ribazole-5'-P as substrates, CobS activity can be quantified by measuring the formation of radiolabeled AdoCbl-5'-P. This method has been used successfully to measure specific activities of approximately 8-22 nmol of product per min per mg of protein for S. typhimurium CobS .

  • HPLC-based assay: Products of the CobS reaction can be isolated by reverse-phase HPLC after derivatization with KCN. The reaction products can be identified based on their retention times compared to authentic standards and by UV-visible spectroscopy. For example, the CNCbl-5'-P product has been observed to elute at approximately 33.5 minutes, compared to 36.9 minutes for authentic CNCbl .

  • Growth complementation assay: The biological activity of the CobS reaction product can be verified by testing its ability to support the growth of a cobalamin auxotroph bacterial strain .

  • Liposome reconstitution assay: Given that CobS is a membrane protein, reconstituting the purified enzyme into liposomes allows for investigation of the effect of the lipid bilayer on CobS function .

How does the structure of S. medicae CobS compare to that of other bacterial species?

While the exact structure of S. medicae CobS has not been elucidated according to the available search results, we can make informed comparisons based on what is known about CobS homologues in other bacteria.

To compare CobS proteins across species, researchers can conduct:

  • Sequence alignment analysis: Comparing amino acid sequences to identify conserved domains, motifs, and potential functional residues

  • Hydropathy plot analysis: Predicting transmembrane domains and topology models

  • Homology modeling: Building structural models based on any available crystal structures of related proteins

A comparative table of predicted CobS properties across species might look like this:

SpeciesPredicted Size (kDa)Number of Predicted Transmembrane DomainsKey Conserved MotifsUnique Features
S. medicae~38-42*8-10*Active site residues*Species-specific insertions*
S. typhimurium38.79Nucleotide binding motifWell-characterized activity
E. coli38.59Similar to S. typhimuriumHigh sequence identity to S. typhimurium

*Note: These values represent predictions based on typical CobS proteins and would need to be experimentally verified for S. medicae CobS.

What are the optimal conditions for in vitro reconstitution of S. medicae CobS activity?

Based on studies of CobS from other bacteria, the optimal conditions for in vitro reconstitution of S. medicae CobS activity would likely include:

  • Membrane environment: Since CobS is a membrane protein, its activity is dependent on a proper lipid environment. Researchers have successfully reconstituted CobS into liposomes to investigate the effect of the lipid bilayer on enzyme function . The lipid composition might significantly affect activity and should be optimized.

  • Substrate concentrations: For S. typhimurium CobS, the reaction typically uses adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-5'-phosphate as substrates . Optimal concentrations should be determined through kinetic analysis.

  • Buffer conditions: pH, ionic strength, and specific ion requirements would need to be optimized. For membrane proteins, these conditions can dramatically affect stability and activity.

  • Detergent selection: If working with purified CobS outside of a liposome system, the choice of detergent is critical for maintaining protein structure and function.

  • Cofactor requirements: Any additional cofactors or metal ions required for optimal activity should be identified through systematic testing.

A methodical approach to optimization would involve varying these parameters individually while monitoring CobS activity through one of the assays described in section 1.4.

How might CobS function contribute to the symbiotic relationship between S. medicae and Medicago plants?

The contribution of CobS to the S. medicae-Medicago symbiosis represents an intriguing area of research that connects cobamide metabolism with symbiotic efficiency. While direct evidence is not presented in the search results, we can formulate hypotheses based on known aspects of rhizobial symbiosis and cobamide metabolism:

  • Metabolic support during nodulation: Cobalamin is an essential cofactor for several metabolic enzymes. Efficient cobalamin synthesis via CobS could provide metabolic advantages during the energy-intensive process of nodule formation.

  • Adaptation to host environment: The symbiotic environment within root nodules presents unique challenges. CobS-dependent cobalamin synthesis might be specifically adapted to function under these conditions, possibly with unique regulatory mechanisms.

  • Potential host specificity factors: The specificity of S. medicae for certain Medicago species (as opposed to S. meliloti's preference for other hosts) could partially involve metabolic adaptations, including differences in cobamide metabolism . The paired Medicago receptors that mediate broad-spectrum resistance to certain S. meliloti strains might indirectly influence the metabolic requirements for successful symbiosis.

  • Correlation with symbiotic efficiency: Researchers could investigate whether natural variations in the cobS gene correlate with differences in symbiotic efficiency among S. medicae strains. Population genomics approaches have been applied to S. medicae and could be extended to examine correlations between cobS variants and symbiotic phenotypes.

What methodological challenges exist in studying the reaction mechanism of membrane-bound CobS?

Studying the reaction mechanism of membrane proteins like CobS presents several significant challenges:

  • Protein purification difficulties: Membrane proteins are notoriously difficult to purify in their active form. For CobS, this challenge has been partially addressed through improved purification protocols that yield highly pure protein (96% homogeneity) , but maintaining activity during purification remains challenging.

  • Recreating the membrane environment: The membrane association of CobS is conserved across species, suggesting that this localization is functionally important . Researchers must carefully recreate appropriate membrane conditions, either through detergent selection or liposome reconstitution, to study the native function of CobS.

  • Substrate availability: The substrates for CobS (adenosylcobinamide-GDP and α-ribazole-5'-phosphate) are complex molecules that are not commercially available. Researchers must either synthesize these substrates or generate them enzymatically using preceding enzymes in the pathway .

  • Monitoring reaction kinetics: Due to the membrane-bound nature of CobS and the complexity of its substrates and products, traditional enzyme kinetics approaches may be difficult to apply. Specialized techniques, such as those combining HPLC analysis with spectroscopic methods, are required .

  • Structural analysis limitations: Obtaining high-resolution structural information for membrane proteins is considerably more challenging than for soluble proteins. This limits our understanding of the structural basis for CobS function.

How can site-directed mutagenesis be used to identify key functional residues in S. medicae CobS?

Site-directed mutagenesis represents a powerful approach for identifying key functional residues in enzymes like CobS. For S. medicae CobS, researchers could employ the following strategy:

  • Target selection based on conservation: Identify highly conserved residues across CobS homologs from different bacterial species through multiple sequence alignment. Conservation suggests functional importance.

  • Structure-based predictions: Use homology models (if available) or predictions of transmembrane topology to identify residues likely to be involved in substrate binding or catalysis.

  • Systematic mutagenesis approach: Create single amino acid substitutions, focusing on:

    • Charged residues in predicted transmembrane domains (often functionally important)

    • Residues in predicted substrate binding pockets

    • Conserved motifs identified through bioinformatics analysis

  • Functional assessment of mutants: Test the activity of each mutant using:

    • In vitro activity assays (as described in section 1.4)

    • In vivo complementation of cobS-deficient strains

    • Substrate binding analysis to distinguish between effects on binding vs. catalysis

  • Interpretation of results: Categorize mutations based on their effects:

    • Complete loss of function (likely essential catalytic residues)

    • Reduced activity (important but not essential residues)

    • Altered substrate specificity (residues involved in substrate recognition)

This approach has been successfully used for CobS variants, leading to the identification of residues and motifs critical for cobamide synthase function . Similar approaches applied to S. medicae CobS would provide valuable insights into the structure-function relationships of this important enzyme and potentially reveal species-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.