Recombinant Sinorhizobium medicae Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Sinorhizobium medicae PlsY is a 203-amino acid protein (UniProt ID: A6U809) expressed in Escherichia coli with an N-terminal His tag for purification . The enzyme catalyzes the transfer of an acyl group from acyl-phosphate to glycerol-3-phosphate (G3P), forming lysophosphatidic acid (LPA), the first step in phospholipid biosynthesis .

PropertyDetail
Host OrganismSinorhizobium medicae
Expression SystemE. coli
Molecular Weight~24 kDa (calculated)
TagN-terminal His tag
Amino Acid Range1–203

Catalytic Mechanism

PlsY utilizes acyl-phosphate as an acyl donor, distinguishing it from acyl-ACP-dependent GPATs in plants . The reaction proceeds via a two-step process:

  1. Acyl transfer: Acyl group from acyl-phosphate is transferred to G3P.

  2. LPA formation: Produces lysophosphatidic acid, a precursor for phosphatidic acid and membrane lipids .

Metabolic Context in S. medicae

  • Symbiosis Adaptation: S. medicae bacteroids exhibit upregulated TCA cycle enzymes during nitrogen fixation , suggesting PlsY-mediated lipid synthesis supports membrane biogenesis under symbiotic conditions.

  • Carbon Storage Regulation: Free-living S. medicae prioritizes poly-β-hydroxybutyrate (PHB) and glycogen synthesis, processes repressed in symbiosis . PlsY activity may shift lipid flux during host adaptation.

Enzyme Kinetics and Inhibition

  • Substrate Specificity: Prefers C16:0 and C18:1 acyl-phosphates .

  • Inhibition: Palmitoyl-CoA noncompetitively inhibits PlsY, suggesting feedback regulation .

Comparative Genomics

  • Homologs: PlsY is conserved in Streptococcus pneumoniae and Arabidopsis thaliana, but S. medicae PlsY lacks chloroplast-targeting sequences found in plant GPATs .

  • Symbiotic Specificity: Unlike Sinorhizobium meliloti, S. medicae lacks the rns1 gene linked to nodulation restriction in Medicago truncatula, potentially allowing broader host compatibility .

Applications and Implications

  • Metabolic Engineering: Recombinant PlsY enables synthetic biology approaches to optimize bacterial lipid production .

  • Agricultural Biotechnology: Understanding PlsY’s role in S. medicae symbiosis could improve nitrogen-fixing inoculants for legumes .

Open Questions

  • Does PlsY activity vary between free-living and symbiotic states of S. medicae?

  • How do PlsY inhibitors affect rhizobial survival in soil versus plant hosts?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Smed_0934; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Sinorhizobium medicae (strain WSM419) (Ensifer medicae)
Target Names
plsY
Target Protein Sequence
MDIFSWQLGLPSTLACLVFGYLLGSIPFGLILTRMAGLGDVRKIGSGNIGATNVLRTGNK KLAATTLLLDALKGTAAAAIASLWGVEAGMAAGLAAFLGHLFPVWLSFKGGKGVATYIGV LLGLVPVMVLLFAAAWLAVAKISRYSSLSALVATAIIPVALYATGNGKVALLFAVMTLIA WVKHRANIQRLMSGTESRIGEKG
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its function in Sinorhizobium medicae?

Glycerol-3-phosphate acyltransferase (plsY) is an integral membrane protein that plays a crucial role in the biosynthetic pathway that initiates phosphatidic acid formation in bacterial membrane phospholipid biosynthesis. In Sinorhizobium medicae, as in other bacteria, plsY catalyzes the transfer of acyl groups from acylphosphate to glycerol 3-phosphate . This reaction is part of the most widely distributed pathway for bacterial membrane phospholipid synthesis, where acyl-acyl carrier protein is first converted to acylphosphate by PlsX, and then plsY transfers the acyl group to glycerol 3-phosphate . The enzyme is fundamental to bacterial membrane integrity and function, making it essential for the survival and symbiotic capabilities of S. medicae.

How does the structure of plsY relate to its function?

The structural architecture of plsY is intimately connected to its enzymatic function. Based on studies of Streptococcus pneumoniae PlsY (which shares conserved features with S. medicae plsY), the protein has five membrane-spanning segments with the amino terminus and two short loops located on the external face of the membrane . The enzyme contains three larger cytoplasmic domains, each with a highly conserved sequence motif that is critical for catalysis . This membrane topology allows plsY to access both its substrates—acylphosphate in the cytoplasm and glycerol 3-phosphate, which may approach from either side of the membrane. The specific arrangement of transmembrane segments positions the active site domains optimally for substrate binding and catalytic function.

What are the key conserved motifs in plsY and their significance?

PlsY contains three highly conserved sequence motifs that are critical for its catalytic function:

Motif 1: Contains essential serine and arginine residues that are vital for the enzyme's activity . Site-directed mutagenesis has shown that alterations to these amino acids significantly impair enzyme function.

Motif 2: Exhibits characteristics of a phosphate-binding loop . Mutations of conserved glycines in this motif to alanines result in a Km defect for glycerol 3-phosphate binding, indicating that this motif corresponds to the glycerol 3-phosphate binding site .

Motif 3: Contains a conserved histidine and asparagine that are important for activity, as well as a glutamate that is critical to the structural integrity of PlsY .

These motifs work in concert to position substrates correctly and facilitate the acyltransferase reaction.

How does recombination influence the genomic diversity of Sinorhizobium medicae plsY?

Recombination plays a significant role in shaping the genomic diversity of S. medicae, including genes like plsY. Research has shown that homologous recombination has differential impacts on polymorphism patterns across the bacterial genome . The chromosome typically shows less impact from recombination compared to the chromid pSMED01 and megaplasmid pSMED02 . This pattern suggests that genes located on different replicons may evolve at different rates and under different selective pressures.

For plsY and related genes involved in membrane phospholipid biosynthesis, this recombination dynamic could influence functional diversity and adaptation. Studies indicate that recombination occurs preferentially within and among loci located on megaplasmids rather than within the chromosome . This pattern of recombination may allow different selection patterns at different loci, potentially facilitating adaptation to diverse host plants and environmental conditions.

How do selective pressures influence the evolution of plsY in symbiotic bacteria?

The evolution of plsY in symbiotic bacteria like S. medicae is shaped by complex selective pressures related to both bacterial survival and symbiotic interactions. Research on the selective patterns in Sinorhizobium populations has revealed evidence of selection within the main symbiotic regions located on different megaplasmids . While plsY specifically wasn't examined in these studies, the broader pattern suggests that genes involved in critical cellular functions like membrane biogenesis exist in a complex selective landscape.

The selective pressures on plsY likely include the need to maintain efficient phospholipid biosynthesis while potentially adapting to the specific membrane requirements of symbiosis. The enzyme must function efficiently in diverse soil conditions and during the transition to symbiotic life within plant nodules. These multiple selective forces may explain why certain domains of the enzyme are highly conserved across bacterial species, while other regions may show greater variability.

What are the comparative differences between Sinorhizobium medicae plsY and glycerol-3-phosphate acyltransferases from other organisms?

Glycerol-3-phosphate acyltransferases show notable structural and functional differences across different organisms, reflecting their evolutionary adaptation to specific cellular contexts. In mammals, four isoforms of GPATs have been identified, classified based on subcellular localization, substrate preferences, and NEM sensitivity . These include GPAT1 and GPAT2 localized in the mitochondrial outer membrane, and GPAT3 and GPAT4 localized in the endoplasmic reticulum membrane .

In contrast, bacterial plsY, including that from S. medicae, represents a distinct acyltransferase family that uses acylphosphate as an acyl donor rather than acyl-CoA, which is the substrate for mammalian GPATs . Additionally, bacterial plsY has a unique membrane topology with five membrane-spanning segments and three conserved cytoplasmic domains essential for catalysis .

The substrate binding pocket for glycerol-3-phosphate in some GPAT enzymes consists of several conserved positively charged amino acids , which may have analogous features in the S. medicae plsY despite the evolutionary distance. These comparative differences highlight the specialized adaptation of plsY to bacterial phospholipid metabolism.

What are the optimal methods for expressing and purifying recombinant Sinorhizobium medicae plsY?

Expressing and purifying recombinant S. medicae plsY presents unique challenges due to its nature as an integral membrane protein with multiple transmembrane domains. Based on published methodologies for similar proteins, a comprehensive approach might include:

  • Expression System Selection: Using E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3), with expression vectors containing strong inducible promoters like T7.

  • Fusion Tags: Incorporating N-terminal or C-terminal tags (His6, MBP, or SUMO) to facilitate purification while considering the membrane topology of plsY to ensure tag accessibility.

  • Detergent Solubilization: Careful selection of detergents for membrane solubilization is critical. Common options include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin.

  • Purification Protocol: A multi-step purification typically involving:

    • Initial enrichment by differential centrifugation

    • Detergent solubilization of membranes

    • Affinity chromatography using the fusion tag

    • Size exclusion chromatography for final purification

  • Quality Assessment: Evaluating protein purity by SDS-PAGE, Western blotting, and assessing functionality through activity assays against glycerol-3-phosphate and acylphosphate substrates.

The exact protocol would need optimization based on the specific properties of S. medicae plsY and the intended downstream applications.

How can the enzymatic activity of recombinant plsY be accurately measured?

Accurate measurement of recombinant plsY enzymatic activity requires careful consideration of its membrane association and substrate specificity. A robust activity assay would typically involve:

  • Substrate Preparation:

    • Synthesizing or obtaining pure acylphosphate (the acyl donor)

    • Using radiolabeled or fluorescently labeled glycerol-3-phosphate to track product formation

  • Reaction Conditions:

    • Buffer optimization (pH 7.0-8.0 with appropriate ionic strength)

    • Inclusion of necessary cofactors or metal ions

    • Temperature control (typically 30-37°C for most bacterial enzymes)

  • Activity Measurement Methods:

    • Radiometric assays tracking the incorporation of labeled substrates into lysophosphatidic acid

    • HPLC or LC-MS based methods for direct product quantification

    • Coupled enzyme assays that link product formation to measurable signals

  • Controls and Validation:

    • Testing enzyme inhibition with known inhibitors like palmitoyl-CoA, which has been shown to noncompetitively inhibit plsY

    • Using site-directed mutants of conserved residues as negative controls

  • Data Analysis:

    • Determining kinetic parameters (Km, Vmax) for both substrates

    • Assessing the effects of different acyl chain lengths and saturation on activity

These methods would provide comprehensive insights into the catalytic properties of recombinant S. medicae plsY.

What site-directed mutagenesis approaches are most effective for studying plsY function?

Site-directed mutagenesis represents a powerful approach for dissecting the functional roles of specific amino acid residues in plsY. Based on published research, the following strategies are particularly effective:

  • Target Selection Based on Conserved Motifs:

    • Motif 1: Focus on the essential serine and arginine residues identified in previous studies

    • Motif 2: Target the conserved glycines in the phosphate-binding loop

    • Motif 3: Examine the conserved histidine, asparagine, and glutamate residues

  • Mutation Types:

    • Conservative substitutions (e.g., Ser→Thr, Arg→Lys) to test the importance of specific chemical properties

    • Non-conservative substitutions (e.g., Ser→Ala, Arg→Ala) to completely eliminate side chain functionality

    • Charge inversions (e.g., Arg→Glu) to test electrostatic interactions

  • Technical Approaches:

    • PCR-based methods like QuikChange for single mutations

    • Gibson Assembly or similar techniques for introducing multiple mutations simultaneously

    • CRISPR-Cas9 methods for genomic integration of mutations

  • Functional Assessment:

    • Complementation assays in plsY-deficient bacterial strains

    • In vitro activity measurements comparing wild-type and mutant proteins

    • Substrate binding affinity determinations through techniques like isothermal titration calorimetry

These approaches would allow for systematic examination of structure-function relationships in S. medicae plsY, particularly focusing on the three conserved motifs that are critical for catalysis.

How should researchers interpret kinetic data from plsY enzyme assays?

Interpreting kinetic data from plsY enzyme assays requires careful consideration of the enzyme's membrane-associated nature and bi-substrate reaction mechanism. Researchers should approach data analysis using these guidelines:

  • Model Selection:

    • Apply appropriate bi-substrate kinetic models (ping-pong or sequential) to analyze the reaction mechanism

    • Use Lineweaver-Burk, Eadie-Hofstee, or non-linear regression analyses to determine kinetic parameters

  • Parameter Interpretation:

    • Km values for glycerol-3-phosphate typically reflect binding affinity in the phosphate-binding loop (Motif 2)

    • Vmax values should be normalized to enzyme concentration, considering the challenges of quantifying membrane proteins

    • Inhibition patterns (competitive, noncompetitive, uncompetitive) provide insights into substrate binding sites

  • Comparative Analysis:

    • Compare wild-type enzyme with site-directed mutants to assess the contribution of specific residues

    • Examine kinetic parameters across different reaction conditions to understand environmental influences

  • Potential Pitfalls:

    • Detergent effects may influence apparent kinetic parameters and should be controlled for

    • Substrate solubility limitations, particularly for acylphosphates with long hydrocarbon chains

    • Product inhibition effects that may complicate kinetic analyses

  • Data Presentation:

    • Present data in standardized formats including Michaelis-Menten plots, Lineweaver-Burk plots, and tabulated kinetic constants

    • Include measures of statistical significance and experimental replication

Rigorous kinetic analysis provides fundamental insights into the catalytic mechanism of plsY and its substrate specificity.

What approaches are recommended for analyzing plsY sequence conservation across bacterial species?

Analysis of plsY sequence conservation across bacterial species requires sophisticated bioinformatics approaches to extract meaningful evolutionary and functional insights. Recommended methodologies include:

  • Sequence Retrieval and Alignment:

    • Use databases like UniProt, NCBI, or specialized bacterial genome databases to gather plsY sequences

    • Perform multiple sequence alignments using tools like MUSCLE, MAFFT, or T-Coffee with parameters optimized for membrane proteins

    • Generate profile hidden Markov models to identify distant homologs

  • Conservation Analysis:

    • Calculate per-site conservation scores using methods like Jensen-Shannon divergence

    • Map conservation onto known or predicted structural models

    • Identify ultra-conserved residues, particularly within the three critical motifs

  • Phylogenetic Analysis:

    • Construct phylogenetic trees using maximum likelihood, Bayesian, or distance-based methods

    • Test different evolutionary models to find the best fit for plsY evolution

    • Correlate plsY phylogeny with bacterial taxonomy and ecological niches

  • Selection Pressure Analysis:

    • Calculate dN/dS ratios to identify sites under purifying, neutral, or positive selection

    • Use methods like PAML, FEL, or MEME to detect episodic or pervasive selection

    • Interpret selection patterns in the context of known functional domains

  • Visualization and Interpretation:

    • Visualize conservation patterns using tools like ConSurf or WebLogo

    • Integrate conservation data with structural information when available

    • Correlate highly conserved regions with experimental functional data

These approaches allow researchers to develop hypotheses about functionally critical residues and evolutionary adaptations in plsY across different bacterial lineages.

How can researchers integrate structural and functional data to understand plsY mechanism?

Integrating structural and functional data provides the most comprehensive understanding of plsY mechanism. Researchers should consider the following approaches:

  • Structural Modeling Approaches:

    • Homology modeling based on available crystal structures of related acyltransferases

    • Ab initio or threading approaches for regions with low sequence similarity

    • Molecular dynamics simulations to understand protein flexibility and substrate interactions

    • Prediction of transmembrane topology using methods like TMHMM and comparison with experimental data from the substituted cysteine accessibility method

  • Structure-Function Correlation:

    • Map mutagenesis data onto structural models to identify functional hotspots

    • Correlate the three conserved motifs with their structural contexts

    • Analyze the spatial relationships between catalytic residues and substrate binding sites

  • Computational Docking and Simulation:

    • Perform substrate docking to predict binding modes for glycerol-3-phosphate and acylphosphate

    • Use quantum mechanics/molecular mechanics approaches to model the reaction mechanism

    • Analyze potential inhibitor binding, such as the noncompetitive inhibition by palmitoyl-CoA

  • Experimental Validation:

    • Design mutations based on structural predictions and test enzymatic activities

    • Use structural information to guide the design of chemical probes or inhibitors

    • Implement hydrogen-deuterium exchange mass spectrometry to validate predicted flexible regions

  • Data Integration Framework:

    • Develop comprehensive models that incorporate multiple data types:

    • Sequence conservation data

    • Mutagenesis results

    • Kinetic parameters

    • Predicted structures

    • Phylogenetic information

This integrated approach would provide a mechanistic understanding of how plsY catalyzes the acyl transfer reaction and insights into its evolutionary adaptations across bacterial species.

How does S. medicae plsY compare to plsY in other Sinorhizobium species?

Comparative analysis of plsY across Sinorhizobium species reveals important insights into evolutionary conservation and potential functional adaptations. Studies of Sinorhizobium genomes, including S. medicae and S. meliloti, provide context for understanding plsY evolution:

  • Sequence Conservation Patterns:

    • Core functional motifs in plsY are highly conserved across Sinorhizobium species, reflecting the essential nature of phospholipid biosynthesis

    • Species-specific variations may occur in less functionally constrained regions, potentially reflecting adaptation to different host plants

  • Genomic Context:

    • The genomic location of plsY and surrounding genes can vary between species

    • In S. medicae, the genome includes a chromosome and several replicons including pSMED01, pSMED02, and pSMED03

    • Comparative genomic studies of S. meliloti and S. medicae have shown they have different gene content despite being taxonomically related

  • Selective Pressures:

    • The pattern of selection acting on plsY may differ between species based on their ecological niches

    • Studies of symbiotic regions in Sinorhizobium genomes have shown evidence of different selection patterns, with purifying selection or selective sweeps in some regions and balancing selection in others

  • Functional Implications:

    • Differences in plsY between species may reflect adaptations to different host plants or environmental conditions

    • The conservation of catalytic motifs suggests functional constraints despite potential adaptation in other regions

These comparative analyses provide insights into the evolution of plsY in the context of Sinorhizobium adaptation to diverse symbiotic relationships.

What is known about the gene organization and expression regulation of plsY in S. medicae?

The gene organization and expression regulation of plsY in S. medicae reflect its essential role in phospholipid biosynthesis and potential integration with symbiotic functions:

  • Gene Organization:

    • In bacterial systems, plsY typically exists in operons or gene clusters related to phospholipid biosynthesis

    • The gene may be located on the chromosome rather than on symbiotic plasmids, as genes involved in core metabolic functions tend to be chromosomally encoded

    • Genomic studies of S. medicae strains have revealed variations in gene content across isolates, suggesting potential diversity in the genetic context of plsY

  • Regulation Mechanisms:

    • Expression regulation likely involves responses to membrane stress, phospholipid precursor availability, and developmental cues

    • Potential transcriptional regulators may include those responsive to fatty acid metabolism and membrane homeostasis

    • The correlation between plsY expression and symbiotic efficiency has not been extensively characterized but may represent an important regulatory dimension

  • Comparative Expression Analysis:

    • Studies of Sinorhizobium gene expression during symbiosis have shown complex regulation patterns

    • Different stages of nodule formation and nitrogen fixation may involve different expression levels of genes involved in membrane biogenesis

  • Genomic Context Considerations:

    • The shotgun sequencing data from 12 isolates of S. medicae provides insights into genome organization, with reads mapping to different replicons at proportions similar to their relative sizes

    • The chromosome, pSMED01, and pSMED02 appear to have similar copy numbers per cell, while pSMED03 may have 2-3 fold higher copy number

Understanding the genomic context and regulation of plsY provides insights into how this essential enzyme is integrated into the broader metabolic and symbiotic functions of S. medicae.

How have comparative genomic studies contributed to our understanding of plsY function in symbiotic bacteria?

Comparative genomic studies have significantly enhanced our understanding of plsY function in symbiotic bacteria through several key contributions:

  • Identification of Conservation Patterns:

    • Population genomics studies of Sinorhizobium isolates have revealed patterns of conservation and diversity across the genome

    • The chromosome typically shows low sequence polymorphism, consistent with the high density of housekeeping genes

    • For genes like plsY involved in essential functions, this conservation pattern provides insights into functional constraints

  • Evolutionary Dynamics:

    • Studies have shown that homologous recombination has differential impacts across the genome, with less impact on chromosomal genes compared to plasmid-borne genes

    • This pattern suggests that genes involved in core functions like phospholipid biosynthesis may evolve under different constraints than symbiosis-specific genes

  • Pan-genome Exploration:

    • Analysis of the pan-genome across Sinorhizobium isolates has identified core genes (present in all strains) and accessory genes (present in some strains)

    • PlsY likely belongs to the core genome, reflecting its essential metabolic function

    • Variations in plsY sequence or regulation may contribute to adaptive phenotypes in different isolates

  • Host-Symbiont Interactions:

    • Comparative genomics has revealed selection patterns in symbiotic regions, including purifying selection in nodulation genes and balancing selection in exopolysaccharide production genes

    • These patterns reflect interactions between host plants and bacterial symbionts, potentially including conflict between plants and "cheater" bacterial genotypes

    • While plsY is not directly involved in nodulation, its role in membrane biosynthesis may indirectly influence symbiotic efficiency

These comparative approaches have provided a broader context for understanding how plsY functions within the complex genomic landscape of symbiotic bacteria like S. medicae.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.