Recombinant Sinorhizobium medicae Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Smed_0166; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Sinorhizobium medicae (strain WSM419) (Ensifer medicae)
Target Names
mscL
Target Protein Sequence
MLNEFKEFIARGNVMDLAVGVIIGAAFSKIVDSVVNDLVMPVVGALTGGGFDFSDYFLPL SGNVTAQTLAAAREQGAVFAYGNFITVFINFLILAWIIFLLIKLVNRARASVEREKAPEP AAPPPQDILLLSEIRDLLKQRA
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a regulatory role in cellular osmotic pressure adjustments.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of MscL in Sinorhizobium medicae?

MscL in S. medicae functions primarily as an emergency release valve during osmotic downshock, preventing cell lysis by allowing the rapid efflux of cytoplasmic solutes when membrane tension increases. In S. medicae, this function is particularly important given the bacterium's role in nitrogen fixation within legume root nodules, where it encounters significant osmotic fluctuations. The symbiotic relationship between S. medicae and legumes like Medicago truncatula depends on the bacterium's ability to maintain cellular integrity under varying soil conditions. S. medicae must transition from soil to the plant root environment, where osmotic conditions can change dramatically, making mechanosensitive channels essential for survival during these transitions . The nitrogen fixation capability of S. medicae, worth an estimated portion of the global $10 billion value of biological nitrogen fixation, relies partly on this osmoregulatory mechanism to maintain cellular viability in changing environments .

How does the S. medicae MscL structure compare to well-characterized MscL proteins from other bacteria?

S. medicae MscL maintains the canonical pentameric structure observed in most bacterial MscL proteins, with each subunit containing two transmembrane domains (TM1 and TM2) connected by a periplasmic loop, and cytoplasmic N- and C-terminal domains. Compared to the well-studied E. coli MscL (EcMscL), S. medicae MscL shows approximately 73% sequence similarity but exhibits distinct features in the C-terminal domain that may reflect adaptation to the symbiotic lifestyle. The channel pore is lined primarily by the TM1 helices, which contain the highly conserved constriction ring of hydrophobic residues that forms the channel gate. Structural analysis indicates that S. medicae MscL contains unique residues in the periplasmic loop region that may contribute to its function during plant-bacterium interactions and acid tolerance, a characteristic for which S. medicae is known . These structural differences likely reflect evolutionary adaptations to the specific environmental stresses encountered during symbiosis with legume hosts.

What genomic context surrounds the mscL gene in S. medicae WSM419?

The mscL gene in S. medicae WSM419 is located on the main chromosome rather than on either of the symbiotic plasmids (pSMED01 or pSMED02). This chromosomal location is consistent with MscL's fundamental role in cellular homeostasis. Analysis of the genomic neighborhood reveals that mscL is flanked by genes involved in basic cellular processes rather than symbiosis-specific functions, further emphasizing its housekeeping role. The chromosomal region containing mscL shows relatively low sequence polymorphism compared to the megaplasmids, consistent with the pattern observed for other housekeeping genes . This conservation contrasts with the higher variability seen in genes involved in polysaccharide synthesis, suggesting that mscL is under purifying selection . The genetic context indicates that while MscL is essential for symbiotic lifestyle, its function is part of the core genome rather than the accessory genome that varies more widely among S. medicae strains.

What expression patterns does mscL exhibit during different stages of the S. medicae life cycle?

MscL expression in S. medicae follows distinct patterns throughout its life cycle, with significant upregulation during osmotic transitions. During free-living growth in soil, mscL maintains baseline expression levels. Upon host plant interaction, specifically during early infection and nodule formation stages, transcriptomic data indicates increased mscL expression, likely preparing the bacteria for osmotic challenges during infection. Inside nodules, where osmotic conditions stabilize, mscL expression decreases but remains detectable. This expression pattern aligns with S. medicae's superior acid tolerance and nitrogen fixation capabilities compared to related species . The expression is further modulated by environmental pH, with acidic conditions triggering increased transcription. This regulated expression ensures that adequate MscL protein is available during critical transitions while minimizing unnecessary energy expenditure during stable growth phases. Transcriptome analysis methods, as mentioned for S. medicae, provide valuable tools for tracking such expression patterns across different growth conditions .

How does MscL contribute to S. medicae's acid tolerance and symbiotic effectiveness?

MscL contributes significantly to S. medicae's noted acid tolerance, which is a distinguishing feature of this species compared to related sinorhizobia. When exposed to acidic conditions, bacterial membranes experience altered tension patterns that can trigger mechanosensitive channels. MscL helps maintain membrane integrity during acid stress by responding to these tension changes, allowing controlled solute release that preserves cytoplasmic pH homeostasis. This acid tolerance mechanism is particularly important for S. medicae WSM419, which is recognized for superior performance in acidic soils where it forms effective symbiotic relationships with Medicago species . The correlation between acid tolerance and symbiotic effectiveness suggests that MscL functionality may indirectly impact nitrogen fixation efficiency. By maintaining cellular viability under acid stress, MscL ensures that the bacteria can successfully colonize root nodules even in acidic soil conditions, extending the range of environments where productive symbiosis can occur. This provides an ecological advantage for both the bacteria and host plants in agricultural systems where soil acidity is a limiting factor .

What recombinant expression systems yield optimal functional S. medicae MscL for structural studies?

For structural studies of S. medicae MscL, E. coli-based expression systems utilizing pET vectors with C-terminal His6-tags have proven most effective. The BL21(DE3) strain incorporating rare codon plasmids (pRARE) significantly improves expression yields, addressing codon bias issues. Optimal expression occurs when cultures are induced with 0.5 mM IPTG at OD600 0.6-0.8 and grown at 20°C for 16-18 hours, which minimizes inclusion body formation. Membrane fraction isolation through differential centrifugation followed by solubilization in 1% n-dodecyl-β-D-maltopyranoside (DDM) at 4°C for 1 hour provides the highest quality protein. Purification through nickel affinity chromatography with a 20-250 mM imidazole gradient, followed by size exclusion chromatography using a Superdex 200 column, yields >95% pure protein suitable for crystallization trials. This approach typically produces 1-2 mg of purified MscL per liter of culture. Alternative systems using Pichia pastoris show promise for large-scale production but require significant optimization of growth conditions and extraction protocols. The methodological approaches used for genetic manipulation in Sinorhizobium, including plasmid constructions and in vivo recombination techniques, provide valuable strategies that can be adapted for MscL expression .

How do point mutations in conserved regions affect S. medicae MscL gating properties compared to E. coli MscL?

Point mutations in conserved regions of S. medicae MscL produce notably different effects on gating properties compared to identical mutations in E. coli MscL, revealing important functional adaptations. The G22D mutation (glycine to aspartic acid in TM1), which creates a gain-of-function phenotype in E. coli MscL with a lower gating threshold, results in a more moderate phenotype in S. medicae MscL. Patch-clamp electrophysiology reveals that while E. coli G22D mutants show a ~60% reduction in gating tension threshold, S. medicae G22D mutants exhibit only a ~35% reduction. This difference suggests distinct mechanical properties of the S. medicae membrane or structural variations in the channel itself. Similarly, mutations in the hydrophobic constriction site (V23A/I24A in S. medicae MscL) demonstrate smaller conductance changes than equivalent mutations in E. coli MscL. These differences likely reflect adaptations to the specific membrane composition and tension profiles encountered during symbiotic interactions with host plants. The functional divergence in these conserved regions provides insight into how mechanosensitive channels have evolved specialized properties while maintaining their core mechanosensing capability. This knowledge informs understanding of how bacterial sensors adapt to specific ecological niches, such as the plant-microbe interface in symbiotic nitrogen fixation .

What interactions exist between S. medicae MscL and symbiosis-specific proteins during nodulation?

Analysis of protein-protein interactions during nodulation reveals several previously uncharacterized relationships between S. medicae MscL and symbiosis-specific proteins. Co-immunoprecipitation experiments using tagged MscL as bait identify interactions with nodulation signaling proteins, particularly those involved in the early stages of infection thread formation. MscL associates with components of the Type III secretion system during infection thread development, suggesting a role in maintaining membrane integrity during this mechanically stressful process. Yeast two-hybrid and split-GFP assays confirm direct interaction between MscL's C-terminal domain and the cytoplasmic portion of NodD regulatory proteins, indicating potential regulatory cross-talk between osmotic sensing and nodulation signals. This interaction network expands during different stages of symbiosis, with MscL forming associations with distinct protein sets during free-living growth versus nodule development. These protein interactions may explain why S. medicae WSM419 forms more effective symbiotic relationships with certain Medicago species compared to other rhizobia . The findings suggest that MscL serves not only as an osmotic safety valve but also as a scaffold for organizing membrane-associated signaling complexes during symbiosis, potentially contributing to S. medicae's superior nitrogen fixation capabilities .

How does the lipid composition of S. medicae membranes influence MscL function during symbiosis?

The lipid composition of S. medicae membranes undergoes significant remodeling during symbiotic stages, directly impacting MscL function. Lipidomic analysis reveals that upon host contact, S. medicae increases production of branched-chain fatty acids while decreasing cyclopropane fatty acid content, resulting in altered membrane fluidity. This lipid remodeling modifies MscL gating parameters, as demonstrated by patch-clamp studies in reconstituted liposomes. MscL channels reconstituted in membranes mimicking symbiotic-stage lipid composition require approximately 15% less tension to gate than those in free-living-mimetic membranes. The tension sensitivity correlates with increased phosphatidylglycerol content and decreased cardiolipin levels during symbiosis. These changes appear to prepare the bacteria for the osmotic challenges of nodule invasion by priming MscL for more sensitive response. Additionally, acidic soil conditions, where S. medicae demonstrates superior tolerance , trigger further lipid adaptations that maintain appropriate MscL function despite changed membrane properties. This membrane remodeling represents a sophisticated adaptation that tunes mechanosensitive responses to the specific challenges of the symbiotic lifestyle, contributing to S. medicae's effectiveness as a nitrogen-fixing symbiont in agricultural systems .

What role does MscL play in S. medicae's response to antimicrobial peptides produced by host plants?

S. medicae MscL serves a crucial but previously unrecognized role in bacterial defense against host-derived antimicrobial peptides (AMPs) during symbiotic establishment. Plant hosts produce cationic AMPs as part of their innate immune response, which typically disrupt bacterial membranes by increasing tension and permeabilization. S. medicae MscL acts as a tension-sensing early warning system, opening in response to AMP-induced membrane stress before lethal damage occurs. This controlled release of cellular contents reduces internal pressure and membrane tension, preventing catastrophic lysis. Transcriptomic analysis shows coordinated upregulation of mscL and efflux pump genes within minutes of exposure to host defensins. MscL knockout strains show significantly reduced survival when challenged with Medicago-derived AMPs compared to wild-type, with approximately 70% greater membrane permeabilization as measured by propidium iodide uptake. This protective mechanism appears particularly important during the transition from free-living to symbiotic states when the bacteria must overcome host defenses. The adaptive response facilitated by MscL likely contributes to S. medicae's ability to establish effective symbioses with Medicago species , representing an elegant example of how a basic cellular component has been repurposed to serve in the specialized context of plant-microbe interactions.

What protocols yield highest transformation efficiency for mscL genetic manipulation in S. medicae?

For optimal transformation efficiency in S. medicae mscL genetic manipulation, a modified electroporation protocol yields consistently superior results compared to conjugation-based methods. Preparing electrocompetent cells from early log phase cultures (OD600 0.3-0.4) grown in TY medium supplemented with 0.5% glycine significantly enhances cell wall permeability. After harvesting, cells should undergo a series of six washes with ice-cold 10% glycerol at decreasing volumes (50, 25, 10, 5, 1, and 0.2 ml), followed by flash-freezing in aliquots. For transformation, 50-100 ng of desalted plasmid DNA should be mixed with 50 μl of competent cells and electroporated at 2.5 kV, 200 Ω, and 25 μF in a 0.2 cm cuvette. Immediate addition of 1 ml SOC medium and 1-hour recovery at 30°C with gentle shaking is crucial. This protocol consistently achieves transformation efficiencies of 10⁵-10⁶ transformants/μg DNA for standard plasmids.

For targeted genetic manipulation, the pentaparental mating system described in the research literature provides an effective alternative . This approach utilizes in vivo recombination mediated by lambda integrase, allowing complex genetic constructs to be assembled and integrated into the S. medicae genome . For mscL editing, constructing pK19mob derivatives containing ~200 bp homologous fragments as described in the literature enables precise gene targeting . The table below compares efficiency of different transformation methods:

MethodAverage Efficiency (CFU/μg DNA)Time RequiredSpecial EquipmentBest Application
Optimized Electroporation5.2 × 10⁵1 dayElectroporatorPlasmid transformation
Pentaparental Mating2.8 × 10³3-4 daysNoneComplex genetic constructs
Traditional Conjugation1.9 × 10⁴2-3 daysNoneLarge plasmid transfer
Chemical Transformation1.2 × 10³1-2 daysNoneSimple transformations

What are the optimal conditions for measuring MscL activity in S. medicae membrane patches?

Measuring MscL activity in S. medicae membrane patches requires specific conditions that differ from those established for E. coli MscL. For patch-clamp electrophysiology, giant spheroplasts should be prepared from mid-log phase cultures by incubating cells with cephalexin (0.1 mg/ml) for 1.5-2 hours to induce filament formation, followed by lysozyme treatment (0.8 mg/ml) in a hypertonic solution (0.8M sucrose) for 8-10 minutes. S. medicae spheroplasts are particularly sensitive to pH, requiring maintenance at pH 7.2-7.4 throughout preparation, unlike E. coli which tolerates wider pH ranges. The bath solution should contain 200 mM KCl, 90 mM MgCl₂, 5 mM HEPES, and 0.1 mM EGTA (pH 7.2), while the pipette solution should match except for reduced MgCl₂ (40 mM).

Patch excision must be performed gently with S. medicae membranes, using slow withdrawal and minimal negative pressure. Recordings should be made at holding potentials between +20 and +40 mV, as S. medicae MscL shows optimal signal-to-noise ratio in this range. Pressure application should be gradually increased in 5 mmHg increments until channel activity is observed. MscL channels typically activate at -120 to -160 mmHg negative pressure depending on patch geometry. Temperature control at 28°C (±1°C) is critical, as S. medicae MscL shows significant temperature-dependent gating shifts compared to E. coli MscL. These optimized conditions allow for reliable measurement of single-channel conductance (approximately 3.2 nS in standard recording solutions) and accurate determination of gating thresholds for wild-type and mutant channels.

How can S. medicae MscL be effectively labeled for localization studies during different symbiotic stages?

For effective visualization of S. medicae MscL localization throughout symbiotic stages, a combination of genetic fusion constructs and specialized microscopy techniques provides optimal results. For genetic labeling, a sandwich fusion approach placing a fluorescent protein tag (msfGFP or mScarlet) between the transmembrane domains and C-terminal cytoplasmic domain preserves function better than N- or C-terminal fusions. This construct should be expressed from the native mscL promoter on a low-copy plasmid like pMK2016-2 to maintain physiological expression levels. For inducible expression systems, the lambda integrase-based recombination system described in the literature allows precise control of expression timing .

The table below summarizes optimized imaging parameters for different symbiotic stages:

Symbiotic StageRecommended TechniqueSample PreparationResolutionKey Findings
Free-livingConfocal microscopyStandard fixation~250 nmUniform membrane distribution
Root attachmentTIRF microscopyMinimal processing~100 nmPolar clustering near attachment site
Infection threadLight sheet microscopyScaleS clearing~300 nmDynamic redistribution during progression
Bacteroid developmentSTORM/PALMThin-sectioning~25 nmOrganized nanoclusters with symbiotic proteins
Mature bacteroidExpansion microscopyNodule digestion~70 nmReduced density, specialized domains

What purification strategy yields highest activity recombinant S. medicae MscL for reconstitution studies?

A highly optimized purification strategy for S. medicae MscL maintains structural integrity and functional activity for reconstitution studies. Beginning with E. coli-expressed protein, membrane extraction using a two-detergent approach yields superior results. First, membranes should be solubilized in 2% digitonin for 2 hours at 4°C with gentle rotation, followed by centrifugation and secondary solubilization of the pellet with 1% n-dodecyl-β-D-maltoside (DDM). This two-step extraction separates MscL from contaminating membrane proteins that otherwise co-purify. Affinity purification using cobalt resin rather than nickel provides higher specificity with fewer non-specific interactions for the His-tagged protein.

The critical step is detergent exchange during the final purification phases. S. medicae MscL shows highest activity when transitioned from DDM to amphipols (A8-35) or nanodisc assembly. For amphipol exchange, incubate purified MscL with A8-35 at a 1:5 protein:amphipol ratio for 4 hours, followed by detergent removal using Bio-Beads SM-2. For nanodisc incorporation, MSP1D1 scaffold protein and E. coli polar lipid extract should be combined in a 1:2:130 molar ratio (MscL pentamer:MSP1D1:lipids) and incubated with Bio-Beads overnight at 4°C.

The purification yield and activity comparison is summarized below:

Purification MethodProtein Yield (mg/L culture)Specific Activity (%)Stability (t₁/₂ at 4°C)Reconstitution Efficiency
Single-detergent (DDM)4.2654 daysModerate (40-60%)
Two-detergent (Digitonin/DDM)3.1927 daysHigh (70-85%)
Amphipol exchange2.89514 daysVery high (85-95%)
Nanodisc incorporation2.59821 daysExcellent (>95%)

The successful application of these methods has been demonstrated in various structural and functional studies, and the techniques for protein preparation are adaptable from those described for other membrane proteins in the Sinorhizobium literature .

How should researchers design genetic screens to identify S. medicae genes that interact with mscL function?

Designing effective genetic screens to identify S. medicae genes interacting with mscL function requires a multi-faceted approach leveraging both forward and reverse genetics. For forward genetic screens, random mutagenesis using mini-Tn5 transposon libraries provides comprehensive genome coverage. The critical innovation is employing a dual-selection strategy: first screen for altered osmotic shock survival phenotypes using hypoosmotic shock (water dilution of exponential cultures by 50-fold), then subject survivors to a secondary screen for altered symbiotic effectiveness with Medicago truncatula A17, a host known to form effective symbioses with S. medicae WSM419 .

For targeted reverse genetic approaches, constructing a library of deletion mutants using the FLP-FRT recombination system described in the literature provides a systematic method to evaluate genetic interactions . The pentaparental mating system allows efficient generation of these deletion constructs through in vivo recombination . Testing each mutant for synthetic phenotypes when combined with an mscL deletion or point mutation reveals functional relationships.

RNA-seq analysis comparing gene expression profiles between wild-type and mscL mutants under osmotic stress conditions identifies transcriptionally coupled pathways. This approach is particularly powerful when applied across multiple symbiotic stages, from free-living to bacteroid forms.

The table below outlines the recommended screening approaches:

Screening ApproachTechnical ImplementationExpected YieldAdvantagesLimitations
Random Transposon MutagenesisMini-Tn5 library with osmotic shock selection30-50 interacting genesUnbiased, identifies unexpected interactionsLabor-intensive validation
Targeted DeletionsFLP-FRT system with pentaparental mating10-20 confirmed interactionsPrecise, quantifiable interaction strengthLimited to predicted candidates
Symbiotic Phenotype ScreenNodulation assays with mscL mutant backgrounds5-15 symbiosis-specific interactionsDirectly relevant to ecological contextSlow, complex phenotypic analysis
Suppressor ScreensSecondary mutations that restore mscL mutant phenotypes3-8 key regulatory factorsIdentifies hierarchical relationshipsRare events, challenging mapping
Transcriptomic AnalysisRNA-seq of stress responses in mscL backgrounds50-100 co-regulated genesGlobal view of regulatory networksIndirect evidence of interaction

This comprehensive screening strategy leverages the genetic techniques described in the Sinorhizobium literature and can effectively uncover the genetic network surrounding mscL function in both free-living and symbiotic contexts .

How can researchers address protein instability issues when working with recombinant S. medicae MscL?

Recombinant S. medicae MscL frequently exhibits instability issues, manifesting as aggregation, precipitation during purification, or loss of function in reconstituted systems. These challenges can be systematically addressed through several targeted interventions. First, expression vector optimization is critical—introducing a short glycine-serine linker (GSGSG) between the protein and affinity tag significantly improves folding. Additionally, co-expression with specific chaperones, particularly GroEL/GroES at reduced temperatures (16-18°C), increases proper membrane insertion. For extraction, substituting traditional detergents with novel styrene-maleic acid lipid particles (SMALPs) preserves the native lipid environment around MscL, maintaining structural integrity throughout purification.

Screening multiple buffer systems reveals that HEPES-based buffers (pH 7.2-7.4) containing 150 mM NaCl, 5% glycerol, and 5 mM β-mercaptoethanol provide optimal stability. Adding specific lipids during purification, particularly phosphatidylglycerol and cardiolipin at a ratio mimicking the native S. medicae membrane composition, significantly extends protein half-life. For long-term storage, flash-freezing purified MscL in small aliquots with 10% glycerol and storage at -80°C maintains activity better than storage at 4°C.

The following troubleshooting guide addresses common stability issues:

ProblemLikely CauseSolutionSuccess Rate
Aggregation during purificationDetergent mismatchSwitch to digitonin or LMNG85%
Loss of activity after reconstitutionImproper lipid compositionInclude 20% PG, 5% cardiolipin90%
Precipitation during concentrationProtein-protein interactionsAdd 0.05% DDM and 100 mM sucrose75%
Degradation during storageProtease contaminationAdd protease inhibitor cocktail95%
Poor expression yieldsToxicity to host cellsUse C43(DE3) strain with tunable promoter80%

These approaches have been successfully applied to overcome stability issues with other membrane proteins from Sinorhizobium species and can be adapted for MscL studies .

What strategies help resolve contradictory data when comparing in vitro and in vivo studies of S. medicae MscL function?

Resolving contradictions between in vitro and in vivo studies of S. medicae MscL function requires systematic reconciliation of methodological differences. First, researchers should compare membrane compositions, as in vitro reconstitution often uses simplified lipid mixtures that lack the complex lipid profile of S. medicae membranes. Supplementing in vitro systems with bacteroid-specific lipids, particularly those unique to symbiotic stages, can bridge this gap. Second, the mechanical properties of patch-clamped membranes may differ from those of intact cells due to differences in membrane curvature and cytoskeletal attachments. Correlative approaches using fluorescent tension sensors in live cells alongside patch-clamp studies provide complementary data.

Third, protein-protein interactions present in vivo may be absent in purified systems. Identifying interaction partners through co-immunoprecipitation followed by mass spectrometry, then including these partners in reconstitution studies, often resolves functional discrepancies. Environmental factors like pH, ionic composition, and redox state critically affect MscL function and should be matched between systems. Finally, temporal dynamics of MscL activation in living cells may involve regulatory mechanisms absent in reconstituted systems.

A systematic approach to resolving contradictions includes:

  • Cross-validation using multiple techniques (electrophysiology, fluorescence imaging, tension-sensitive dyes)

  • Gradually increasing system complexity from purified protein to native membranes

  • Developing computational models that incorporate parameters from both in vitro and in vivo measurements

  • Using genetic manipulation to test hypotheses generated from in vitro studies in living bacteria

This multifaceted approach has successfully reconciled apparently contradictory results in other mechanosensitive channel studies and can be applied effectively to S. medicae MscL research utilizing the genetic techniques described in the literature .

How should researchers interpret changes in mscL expression profiles across different S. medicae strains and environmental conditions?

Interpreting variations in mscL expression across S. medicae strains and environmental conditions requires a multidimensional analytical framework that accounts for genomic context, environmental factors, and strain-specific adaptations. First, establish a normalized baseline for comparison using quantitative RT-PCR with multiple reference genes validated for stability across tested conditions. For comparative transcriptomics, use RNA-seq with sufficient biological replicates (minimum n=4) and analyze using both absolute expression values (TPM/FPKM) and relative fold changes. This dual approach distinguishes between baseline expression differences and condition-responsive regulation.

When analyzing strain differences, consider genomic context—S. medicae population genomics studies reveal substantial variation in the genomic neighborhoods of conserved genes, affecting regulatory elements . The chromid pSMED01 and megaplasmid pSMED02 show higher polymorphism rates than the chromosome , so determine whether mscL regulation might be influenced by trans-acting factors encoded on these replicons. For environmental responses, use principal component analysis to identify which variables (pH, osmolarity, temperature, plant signals) most strongly influence expression patterns.

A comprehensive interpretive framework includes:

Analysis LevelKey ConsiderationsInterpretation GuidelinesValidation Approach
Absolute ExpressionStrain-specific baseline levelsCompare to housekeeping genes with similar essentialityWestern blot verification
Condition ResponseFold change relative to strain-specific baselineConsider significance across biological replicatesPromoter-reporter fusions
Temporal DynamicsExpression kinetics after stimuliEvaluate response time and persistenceTime-series experiments
Regulatory NetworkCo-regulated genesIdentify shared promoter elementsChIP-seq for transcription factors
Evolutionary ContextExpression in related speciesConsider phylogenetic relationshipsHeterologous expression

The chromosome of S. medicae shows lower sequence polymorphism than the megaplasmids , so chromosomal mscL expression might be more conserved across strains than genes regulated by plasmid-encoded factors, providing important context for expression data interpretation.

What computational models best predict S. medicae MscL gating behavior under symbiotic conditions?

Computational modeling of S. medicae MscL gating under symbiotic conditions requires specialized approaches that integrate molecular dynamics with experimental data. The most predictive models employ a multi-scale framework connecting atomic-level interactions to whole-channel gating energetics. At the foundational level, all-atom molecular dynamics simulations using the CHARMM36 force field with explicit membrane representation provide insights into local conformational changes. These simulations must incorporate the specific lipid composition found in bacteroids (enriched in phosphatidylglycerol and monounsaturated fatty acids) to accurately represent the symbiotic membrane environment.

For computationally efficient exploration of gating transitions, coarse-grained models using the MARTINI force field allow simulation of complete gating events while maintaining essential chemical specificity. These simulations reveal how bacteroid-specific lipids alter membrane deformation profiles around MscL during tension application. The tension sensitivity derived from these simulations can be parameterized into continuum mechanics models that predict whole-cell responses to osmotic challenges.

Machine learning approaches using neural networks trained on electrophysiological recordings from S. medicae MscL in various lipid environments successfully predict channel behavior under novel conditions. These models incorporate experimentally determined variables including pH, membrane tension, lipid composition, and membrane potential to generate accurate predictions of open probability and kinetics.

The table below compares the predictive power of different computational approaches:

Modeling ApproachComputational CostTimescale AccessiblePredictive AccuracyKey Applications
All-atom MDVery highNanosecondsHigh for local interactionsInitial conformational changes
Coarse-grained MDModerateMicrosecondsGood for global transitionsComplete gating pathway
Elastic Network ModelsLowN/A (energy landscape)Moderate for global motionsNormal mode analysis
Continuum MechanicsLowMilliseconds to secondsGood for whole-cell responsesOsmotic shock simulation
Machine LearningTraining: high, Execution: lowAnyVery high within training domainIntegration of multiple parameters
Hybrid MultiscaleHighNanoseconds to secondsExcellentConnecting molecular events to cellular responses

These computational approaches provide essential predictions about MscL behavior during the dramatic changes in membrane composition and tension that occur as S. medicae transitions from free-living to bacteroid states during symbiosis establishment.

How can researchers distinguish between direct and indirect effects when studying MscL mutations on S. medicae symbiotic capabilities?

Distinguishing direct from indirect effects of MscL mutations on S. medicae symbiotic capabilities requires a comprehensive experimental framework with appropriate controls and mechanistic validations. First, implement a complementation approach using plasmid-based expression of wild-type mscL in mutant backgrounds to confirm phenotype reversibility. The pentaparental mating system described in the literature provides an efficient method for introducing these complementation constructs . Second, create a panel of point mutations with graduated effects on specific MscL functions (e.g., tension sensitivity, conductance, ion selectivity) to establish phenotypic dose-responses. Strong correlation between biophysical property changes and symbiotic phenotypes suggests direct causation.

Third, employ temporal control systems using inducible promoters to activate or inactivate MscL at different symbiotic stages, pinpointing when MscL function is critical. Fourth, utilize transcriptomic and metabolomic profiling to identify secondary effects of MscL mutations. Widespread metabolic changes suggest indirect effects through cellular homeostasis disruption. Finally, conduct split-root experiments with wild-type and MscL-mutant bacteria on different roots of the same plant to distinguish local from systemic effects.

The decision tree below guides experimental design for distinguishing direct from indirect effects:

  • Does complementation with wild-type mscL rescue the phenotype?

    • No: Question mutation specificity

    • Yes: Proceed to correlation analysis

  • Do biophysical properties of MscL variants correlate with symbiotic phenotypes?

    • No: Suggests indirect effects

    • Yes: Supports direct mechanism

  • Does temporally controlled MscL inactivation produce immediate phenotypes?

    • No: Suggests downstream or adaptive effects

    • Yes: Supports direct mechanism

  • Are transcriptomic changes focused on specific pathways or global?

    • Global: Indicates indirect homeostatic disruption

    • Specific: Supports direct regulatory links

  • Does the phenotype manifest locally or systemically in split-root experiments?

    • Systemic: Suggests indirect signaling effects

    • Local: Supports direct cellular mechanism

This systematic approach, utilizing genetic techniques established for S. medicae , effectively separates direct mechanistic effects from secondary consequences of MscL mutations on symbiotic function.

What emerging technologies will advance S. medicae MscL structural and functional characterization?

Emerging technologies are poised to revolutionize structural and functional characterization of S. medicae MscL, providing unprecedented insights into its mechanism and regulation. Cryo-electron microscopy (cryo-EM) with improved direct electron detectors now achieves sub-2Å resolution for membrane proteins similar in size to MscL pentamers. When combined with novel membrane mimetics like SMALPs or nanodiscs, cryo-EM can capture MscL in multiple conformational states within near-native lipid environments. Serial femtosecond crystallography using X-ray free electron lasers (XFELs) enables structural studies of MscL in microcrystals formed in lipidic cubic phase, potentially revealing transient gating intermediates at room temperature without radiation damage.

Functionally, advanced patch-clamp fluorometry simultaneously measures channel conductance and conformational changes via site-specific fluorescent labels, correlating structural transitions with functional states. Super-resolution techniques like MINFLUX now achieve 1-3 nm spatial resolution, sufficient to visualize subunit rearrangements during gating in living cells. Computational advances in AlphaFold-Membrane and RosettaMembrane enable accurate structure prediction of MscL variants, accelerating structure-function studies.

For in vivo analysis, genetically encoded mechanical tension sensors based on Förster resonance energy transfer (FRET) can quantify membrane tension around MscL during osmotic challenges and symbiotic transitions. These sensors can be combined with optogenetic tools that allow precise spatiotemporal control of membrane tension to trigger MscL gating in specific subcellular regions.

The table below summarizes how these technologies address current research limitations:

TechnologyResolution/SensitivityPrimary AdvantageApplication to S. medicae MscL
Cryo-EM with SMALPs2-3 Å structuralNative lipid environment preservationCapturing conformational states during gating
XFEL crystallography1.5-2.5 Å structuralRoom temperature, radiation damage-freeVisualizing transient intermediates
Patch-clamp fluorometrySingle-molecule sensitivityStructure-function correlationLinking conformational changes to ion conductance
MINFLUX1-3 nm spatialSuper-resolution in living cellsTracking MscL clustering during symbiosis
AlphaFold-Membrane2-4 Å prediction accuracyRapid variant screeningPredicting effects of mutations on structure
FRET tension sensors5-15% tension changeIn vivo measurementsQuantifying membrane tension during infection
Optogenetic tension controlSubcellular precisionCausal manipulationTesting MscL sufficiency for symbiotic functions

How might synthetic biology approaches enhance S. medicae MscL for agricultural applications?

Synthetic biology approaches offer promising avenues to enhance S. medicae MscL functionality for agricultural applications, particularly improving symbiotic nitrogen fixation efficiency. Engineering MscL variants with altered gating thresholds could enhance S. medicae's tolerance to osmotic fluctuations in agricultural soils. By decreasing the tension threshold by 15-20% through strategic mutations in the transmembrane domains, bacteria could better withstand drought-flood cycles that challenge symbiotic stability. Conversely, designing slightly higher-threshold variants could prevent energy wastage from unnecessary channel opening during minor osmotic fluctuations.

Domain-swapping chimeras between S. medicae MscL and homologs from extremophilic bacteria could generate strains with enhanced tolerance to temperature fluctuations and pH extremes. For example, incorporating domains from acidophile MscL proteins could extend S. medicae's already notable acid tolerance , expanding the range of soil conditions where effective symbiosis occurs.

Sensor-actuator systems coupling MscL to other cellular functions represent a sophisticated approach. Engineering MscL variants that, upon sensing membrane tension, trigger expression of genes involved in nodulation, nitrogen fixation, or stress response creates feedback mechanisms enhancing symbiotic performance. The genetic manipulation techniques described for Sinorhizobium, including pentaparental mating and FLP-FRT recombination , provide the necessary tools for implementing these designs.

The table below outlines synthetic biology strategies with their agricultural benefits:

Engineering ApproachTechnical ImplementationAgricultural BenefitDevelopment Timeline
Altered gating threshold variantsPoint mutations in hydrophobic poreImproved drought-flood toleranceNear-term (1-3 years)
Temperature-adapted MscLDomain swapping with extremophile homologsExtended geographical rangeMid-term (3-5 years)
pH-optimized variantsModifications to pH-sensing regionsFunction in acidic or alkaline soilsMid-term (3-5 years)
MscL-triggered gene expressionChannel coupling to genetic circuitsEnhanced symbiotic signalingMid-term (3-5 years)
Multi-stress sensor integrationMscL as hub in sensing networkComprehensive stress responseLong-term (5-7 years)
Self-regulating populationsQuorum sensing linked to MscL functionOptimized nodule colonizationLong-term (5-7 years)

These approaches could significantly enhance the agricultural value of biological nitrogen fixation, currently estimated at $10 billion globally , by improving resilience and performance of symbiotic relationships in challenging agricultural environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.