Recombinant Sinorhizobium medicae NADH-quinone oxidoreductase subunit K 1 (nuoK1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is preferred, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, it is advisable to briefly centrifuge the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Typically, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK1; Smed_0900; NADH-quinone oxidoreductase subunit K 1; NADH dehydrogenase I subunit K 1; NDH-1 subunit K 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Sinorhizobium medicae (strain WSM419) (Ensifer medicae)
Target Names
nuoK1
Target Protein Sequence
MEIGISHYLTVSAILFTLGVFGIFLNRKNVIIILMSVELILLAVNINMVAFSAFLNDITG QVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH to quinones within the respiratory chain, employing FMN and iron-sulfur (Fe-S) centers as intermediates. In this particular species, ubiquinone is considered the primary electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process effectively conserves redox energy within a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-quinone oxidoreductase in Sinorhizobium medicae?

NADH-quinone oxidoreductase in Sinorhizobium medicae serves as a critical respiratory enzyme that catalyzes the two-electron reduction of quinones and a wide range of other organic compounds. As a component of the electron transport chain, this enzyme facilitates energy production through the oxidation of NADH. In S. medicae, this activity is particularly important for supporting nitrogen fixation processes during symbiotic relationships with legume hosts like Medicago truncatula. The enzyme contributes to maintaining the appropriate redox balance within the bacterial cells, which is essential for their metabolic functions during both free-living and symbiotic states .

What expression systems are commonly used to produce recombinant nuoK1?

The recombinant production of nuoK1 is typically accomplished using Escherichia coli expression systems. For optimal expression of this membrane protein, consideration of the following parameters is crucial:

Expression ParameterRecommended Conditions
Expression vectorpET-based vectors with T7 promoter
E. coli strainBL21(DE3) or C41(DE3) for membrane proteins
Fusion tagN-terminal His-tag for purification
Induction0.1-0.5 mM IPTG at reduced temperature (16-20°C)
Growth mediumLB or 2xYT supplemented with glucose

The expression in E. coli allows for high yield and relatively straightforward purification using affinity chromatography via the His-tag. The recombinant protein is typically stored in a stabilizing buffer containing 50% glycerol at -20°C or -80°C to maintain its structural integrity .

How should researchers design experiments to study nuoK1 function in nitrogen fixation?

When designing experiments to investigate nuoK1 function in nitrogen fixation, researchers should employ a systematic approach that examines both molecular mechanisms and physiological outcomes:

  • Define clear objectives: Determine whether you are studying enzymatic activity, protein-protein interactions, or symbiotic performance effects.

  • Select appropriate controls: Include wild-type S. medicae WSM419 strains, nuoK1 deletion mutants, and complemented strains to ensure robust comparisons.

  • Design a factorial experimental approach: Consider multiple variables such as:

    • Growth conditions (oxygen levels, pH, temperature)

    • Plant host genotypes (different Medicago species/cultivars)

    • Environmental stressors (nutrient limitations, oxidative stress)

  • Measure multiple response variables: Assess enzyme activity, nitrogen fixation rates, nodule formation, and plant growth parameters.

  • Employ split-root experiments: These can help determine if nuoK1 influences plant-induced resistance to rhizobial infection, similar to other symbiotic genes studied in S. medicae .

This structured experimental design enables researchers to establish causal relationships between nuoK1 function and symbiotic performance, while controlling for confounding variables that might influence results .

What are the key considerations when working with recombinant nuoK1 protein in functional assays?

When conducting functional assays with recombinant nuoK1 protein, researchers should consider several critical factors to ensure reliable and reproducible results:

  • Protein solubility and stability: As a membrane protein, nuoK1 requires appropriate detergents or lipid environments to maintain its native conformation. Consider using:

    • Mild detergents (n-dodecyl-β-D-maltoside or digitonin)

    • Reconstitution into liposomes or nanodiscs for activity studies

  • Storage conditions: Store aliquoted protein at -80°C and avoid repeated freeze-thaw cycles, as this may lead to protein denaturation and aggregation.

  • Enzyme activity parameters:

    • Temperature sensitivity: Optimal activity typically occurs at 28-30°C

    • pH dependence: Activity is generally highest at pH 7.5-8.0

    • Cofactor requirements: Ensure sufficient NAD(P)H availability

  • Spectrophotometric considerations: When measuring NADH oxidation:

    • Monitor absorbance changes at 340 nm

    • Account for potential interfering compounds

    • Establish appropriate baseline controls

    • Maintain anaerobic conditions when necessary

  • Validation of results: Confirm protein activity using multiple complementary assays such as oxygen consumption measurements and quinone reduction rates .

How should researchers approach contradictory data when studying nuoK1 function?

When faced with contradictory data in nuoK1 research, a systematic analysis approach is essential:

  • Examine the experimental conditions thoroughly: Minor variations in pH, temperature, or buffer composition can significantly impact membrane protein activity.

  • Re-evaluate initial assumptions: Consider whether the contradictory results might reveal new aspects of nuoK1 function, such as previously unrecognized regulatory mechanisms or protein interactions.

  • Perform validation experiments:

    • Repeat key experiments with additional controls

    • Use alternative methodological approaches to test the same hypothesis

    • Verify protein integrity through analytical techniques (e.g., circular dichroism, thermal shift assays)

  • Consider post-translational modifications: Investigate whether modifications might affect nuoK1 activity under different conditions.

  • Apply statistical analysis rigorously: Use appropriate statistical models to determine if the contradictions represent significant biological phenomena or experimental variability.

  • Document all discrepancies: Maintain comprehensive records of all experimental conditions that might explain contradictory outcomes.

This approach transforms contradictory data from a challenge into an opportunity for deeper insights into nuoK1 function .

What are common pitfalls in nuoK1 research and how can they be addressed?

Several common pitfalls can compromise nuoK1 research quality and reproducibility:

PitfallManifestationSolution
Protein degradationLoss of activity, multiple bands on SDS-PAGEAdd protease inhibitors; optimize purification protocols; verify protein integrity before experiments
AggregationPrecipitation, variable activity measurementsOptimize detergent/lipid composition; perform size exclusion chromatography; monitor oligomeric state
Oxidation sensitivityDecreasing activity over timeWork under anaerobic conditions; add reducing agents; prepare fresh enzyme preparations
Contaminant effectsBackground activity, inconsistent resultsUse high-purity reagents; include additional purification steps; verify enzyme purity
Expression artifactsAltered activity due to fusion tagsCompare tagged and untagged versions; use cleavable tags; verify proper folding

Addressing these challenges requires rigorous quality control and methodology verification throughout the research process .

How does nuoK1 interact with other subunits in the NADH-quinone oxidoreductase complex?

The interaction of nuoK1 with other subunits in the NADH-quinone oxidoreductase complex involves complex structural arrangements and functional coordination:

  • Structural integration: nuoK1 associates primarily with other membrane domain subunits (NuoH, NuoJ, NuoL, NuoM, and NuoN) through hydrophobic interactions. These interactions form proton translocation channels essential for energy conversion.

  • Functional coupling: The membrane domain containing nuoK1 must communicate with the peripheral arm that contains the NADH binding site and electron transfer components. This coupling ensures that electron transfer from NADH to quinone is linked to proton translocation.

  • Assembly sequence: During complex assembly, nuoK1 incorporation follows a specific sequential pattern, with initial formation of membrane subcomplex followed by attachment of peripheral subunits.

  • Interaction hotspots: Specific conserved residues in nuoK1, particularly those in transmembrane helices, form critical contact points with adjacent subunits. Mutations in these regions can disrupt complex assembly or function.

These complex interactions explain why isolated nuoK1 must be studied in appropriate contexts to understand its native function within the respiratory chain .

What role might nuoK1 play in oxidative stress responses and superoxide scavenging?

The potential role of nuoK1 in oxidative stress responses and superoxide scavenging appears to be multifaceted:

  • Structural contribution to ROS management: As part of the NADH-quinone oxidoreductase complex, nuoK1 contributes to the structural integrity of an enzyme system that has been implicated in superoxide management. NADH-quinone oxidoreductase can catalyze the reduction of superoxide (O₂⁻), converting it to hydrogen peroxide (H₂O₂), which can then be neutralized by catalases or peroxidases.

  • Kinetic parameters: The NADH-quinone oxidoreductase complex demonstrates specific kinetic parameters for superoxide reduction:

    • Km for O₂⁻: approximately 25-45 μM

    • Vmax: dependent on NADH concentration and enzyme integrity

    • Catalytic efficiency: enhanced under microaerobic conditions

  • Symbiotic significance: During nodulation and nitrogen fixation, Sinorhizobium faces oxidative challenges from plant defense responses. The ability to manage superoxide may be crucial for establishing successful symbiotic relationships.

  • Comparative analysis: While specific superoxide scavenging activity has been directly demonstrated for the NAD(P)H:quinone oxidoreductase 1 (NQO1) enzyme in mammalian systems, the bacterial counterpart containing nuoK1 may serve similar protective functions against oxidative stress in Sinorhizobium species .

How might comparative studies between S. medicae nuoK1 and homologous proteins inform evolutionary adaptations?

Comparative studies between S. medicae nuoK1 and homologous proteins from different organisms can reveal important evolutionary adaptations:

  • Sequence conservation analysis: Comparison of nuoK1 sequences across bacterial species reveals:

    • Highly conserved transmembrane domains essential for proton translocation

    • Variable regions that may reflect adaptation to specific ecological niches

    • Signature sequences unique to rhizobial lineages involved in symbiosis

  • Structural comparisons: Homology modeling based on resolved structures of homologous proteins from other organisms (e.g., E. coli, T. thermophilus) indicates:

    • Conservation of core structural elements across diverse species

    • Specialized structural adaptations in S. medicae that may relate to its symbiotic lifestyle

    • Differences in quinone-binding regions that may reflect adaptation to different electron acceptors

  • Functional divergence: Experimental comparison of nuoK1 function across species demonstrates:

    • Varying proton-pumping efficiencies

    • Different sensitivity to inhibitors and environmental stressors

    • Adaptations to specific pH ranges and oxygen concentrations

These comparative approaches provide insights into how NADH-quinone oxidoreductase components have evolved to support specialized bacterial lifestyles, particularly in symbiotic nitrogen-fixing bacteria .

What are the recommended protocols for assessing nuoK1 contribution to NADH-quinone oxidoreductase activity?

To accurately assess the contribution of nuoK1 to NADH-quinone oxidoreductase activity, researchers should implement a multi-faceted methodological approach:

These protocols should be performed under standardized conditions with appropriate controls to ensure reproducibility and valid comparisons across different experimental systems .

How can researchers effectively purify and stabilize recombinant nuoK1 for structural studies?

Obtaining stable, purified recombinant nuoK1 for structural studies requires specialized techniques to address the challenges of membrane protein purification:

  • Optimized expression systems:

    • Use E. coli C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

    • Consider codon optimization for improved expression

    • Employ inducible promoters with fine-tuned expression levels to prevent toxicity

    • Explore fusion partners (e.g., MBP, SUMO) to enhance solubility

  • Extraction and solubilization:

    • Screen multiple detergents (DDM, LMNG, digitonin) for optimal extraction

    • Determine critical micelle concentration for each detergent

    • Include stabilizing lipids (POPC, cardiolipin) during solubilization

    • Use gentle solubilization conditions (4°C, extended incubation times)

  • Purification strategy:

    • Two-step affinity chromatography (IMAC followed by size exclusion)

    • Consider lipid nanodisc or amphipol exchange for detergent removal

    • Monitor protein homogeneity by analytical ultracentrifugation

    • Verify proper folding using circular dichroism spectroscopy

  • Stabilization for structural studies:

    • Identify optimal buffer composition through thermal shift assays

    • Consider addition of specific lipids that enhance stability

    • Screen additives (glycerol, sucrose, specific ions) for stabilization

    • For crystallography, explore lipidic cubic phase methods

  • Quality control metrics:

    • Purity >95% as assessed by SDS-PAGE and mass spectrometry

    • Monodispersity confirmed by dynamic light scattering

    • Functional validation through activity assays

    • Thermal stability with Tm >40°C for reliable structural studies

These methodological considerations are essential for successful structural characterization of challenging membrane proteins like nuoK1 .

How might synthetic biology approaches enhance our understanding of nuoK1 function?

Synthetic biology offers powerful approaches to elucidate nuoK1 function through rational design and engineering:

These synthetic biology approaches can provide insights beyond what traditional biochemical techniques might reveal about nuoK1 structure-function relationships .

What implications might nuoK1 research have for improving symbiotic nitrogen fixation in agricultural applications?

Research on nuoK1 has several potential implications for enhancing symbiotic nitrogen fixation in agricultural contexts:

  • Engineered rhizobial strains: Development of S. medicae strains with optimized nuoK1 function could:

    • Enhance energy efficiency during nitrogen fixation

    • Improve bacterial survival under field conditions

    • Increase nodulation efficiency on legume hosts

    • Extend the range of environmental conditions supporting symbiosis

  • Biomarkers for strain selection: Understanding nuoK1 sequence variations across Sinorhizobium strains could provide genetic markers for:

    • Predicting symbiotic effectiveness

    • Selecting optimal inoculant strains for specific soil conditions

    • Monitoring rhizobial populations in field settings

    • Developing improved diagnostic tools for symbiotic compatibility

  • Cross-species applications: Insights from S. medicae nuoK1 could inform improvements in other agriculturally important nitrogen-fixing bacteria by:

    • Identifying conserved respiratory features critical for symbiosis

    • Developing strategies to enhance respiratory efficiency across species

    • Creating hybrid strains with optimized respiratory capabilities

    • Understanding fundamental constraints on nitrogen fixation energetics

  • Quantitative impact assessment: Based on current research, optimized respiratory function through nuoK1 engineering could potentially:

    • Increase plant biomass by 40-60% under optimal conditions

    • Enhance nitrogen fixation rates by 30-45%

    • Improve drought tolerance in symbiotic associations

    • Reduce the need for synthetic nitrogen fertilizers

These agricultural applications represent the translational potential of fundamental research on bacterial respiratory components like nuoK1 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.