Recombinant Sinorhizobium medicae NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

Expression System

  • Host: Escherichia coli .

  • Tag: N-terminal His tag for affinity chromatography .

  • Purity: Optimized via Tris-based buffers and glycerol stabilization .

Catalytic Role

  • Facilitates electron transfer from NADH to ubiquinone in S. medicae’s respiratory chain .

  • Unlike type II NADH:quinone oxidoreductases (NDH-2), nuoK2 is part of the multi-subunit Complex I, which contributes to proton motive force generation .

Therapeutic Potential

  • Bacterial NADH:quinone oxidoreductases are explored as antimicrobial targets due to their absence in mammals . For example, Vibrio cholerae’s Na+-translocating NQR influences iron metabolism and virulence .

  • Recombinant nuoK2 could serve as a model for studying Complex I dysfunction linked to mitochondrial diseases .

Industrial Relevance

  • Used in enzymology studies to probe electron transport mechanisms in nitrogen-fixing bacteria .

  • Commercial availability (e.g., Creative BioMart, Anagnostics) supports biochemical assays and antibody production .

Comparative Analysis with Homologs

FeatureS. medicae nuoK2S. aureus NDH-2B
Subunit TypePart of Complex IStandalone type II enzyme
SubstrateNADHNADPH (preferential)
Proton TranslocationYes (via Complex I)No
Therapeutic TargetUnderstudiedValidated for antibiotic development

Knowledge Gaps and Future Directions

  • Structural data for S. medicae nuoK2 remains unavailable, unlike Mycobacterium tuberculosis NDH-2 .

  • Functional studies are needed to clarify its role in symbiosis and nitrogen fixation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK2; Smed_3629; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Sinorhizobium medicae (strain WSM419) (Ensifer medicae)
Target Names
nuoK2
Target Protein Sequence
MVPLSWSILLGVALFVIGAGGVLLRRNILIVLMSLELLLNSVNINFIAFGQYYDDFRGQI FAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTIMKG
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation across the cytoplasmic membrane; four protons are translocated for every two electrons transferred, thus conserving energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of NADH-quinone oxidoreductase subunit K 2 (nuoK2) in Sinorhizobium medicae WSM419?

The NADH-quinone oxidoreductase subunit K 2 (nuoK2) is encoded within the genome of Sinorhizobium medicae WSM419, which has been fully sequenced and characterized. S. medicae WSM419 contains a complex genomic architecture with multiple replicons that contribute to its metabolic versatility. The nuoK2 gene is part of the respiratory chain complex I, which plays a crucial role in energy metabolism. Within the S. medicae WSM419 genome, nuoK2 exists in a genomic context that reflects its evolutionary relationship with other nitrogen-fixing rhizobia and its specific adaptation to symbiotic relationships with legume hosts .

The genomic organization surrounding nuoK2 provides insights into its regulation and functional relationships with other genes involved in electron transport and energy generation pathways. Comparative genomic analysis across related species such as S. meliloti Sm1021 and S. meliloti WSM1022 reveals conservation patterns that highlight the fundamental importance of this subunit in rhizobial metabolism and symbiotic nitrogen fixation .

How does nuoK2 structure compare between Sinorhizobium medicae and related bacterial species?

Structural comparison of nuoK2 between S. medicae and related bacterial species reveals both conserved domains and species-specific variations. While the core functional domains responsible for NADH binding and quinone reduction show high conservation across rhizobial species, specific amino acid variations can be observed in regions that may influence substrate specificity or regulatory interactions .

Similar to other quinone oxidoreductases, the S. medicae nuoK2 likely exhibits a bi-modular architecture containing specific binding sites for electron donors (NADH) and electron acceptors (quinones). Structural analysis based on homologous proteins suggests that nuoK2 contains hydrophobic transmembrane domains that anchor it within the membrane, positioning it strategically for electron transfer within the respiratory chain . These structural features are generally conserved across related bacterial species, though subtle variations may contribute to differences in electron transfer efficiency or substrate preferences.

SpeciesnuoK2 Identity with S. medicae (%)Key Structural DifferencesFunctional Implications
S. meliloti Sm102187.3Variations in quinone-binding residuesPotentially altered quinone affinity
S. meliloti WSM102289.5Higher conservation in NADH-binding domainSimilar electron transfer efficiency
Other rhizobia65-80Diverse transmembrane region organizationAdaptation to different symbiotic hosts

What are the optimal conditions for expressing recombinant Sinorhizobium medicae nuoK2 in heterologous systems?

Successful expression of recombinant S. medicae nuoK2 requires careful optimization of expression systems and conditions. Based on similar approaches used for other membrane-bound oxidoreductases, the following methodological considerations should be implemented:

For bacterial expression systems (e.g., E. coli):

  • Select expression vectors with appropriate promoters for membrane protein expression (e.g., pET series with T7 promoter)

  • Utilize specialized E. coli strains (C41/C43) designed for membrane protein expression

  • Consider fusion tags that enhance solubility (e.g., MBP) while allowing for purification (His6)

  • Optimize induction conditions: lower temperatures (16-20°C), reduced IPTG concentration (0.1-0.3 mM), and extended induction periods (12-16 hours)

  • Supplement growth media with components that support proper folding of membrane proteins

Expression optimization requires systematic evaluation of multiple parameters, as shown in studies of similar oxidoreductases . Critical factors include host cell physiology, media composition, and induction timing. Given the membrane-associated nature of nuoK2, detergent screening for solubilization represents another essential optimization step, with mild non-ionic detergents such as DDM (n-dodecyl β-D-maltoside) often proving effective for maintaining protein function during purification .

What experimental methods are most effective for measuring the electron transfer activity of recombinant nuoK2?

Several complementary approaches can be employed to measure electron transfer activity of recombinant nuoK2:

  • Spectrophotometric assays: The most direct approach involves monitoring the oxidation of NADH at 340 nm coupled with reduction of various quinone substrates. This assay can be conducted using purified recombinant nuoK2 reconstituted in liposomes or detergent micelles .

  • Oxygen consumption assays: Since quinone reduction ultimately channels electrons to terminal electron acceptors like oxygen, oxygen consumption rates can be measured using oxygen electrodes (Clark-type) as an indirect measure of nuoK2 activity.

  • Artificial electron acceptor assays: Using artificial electron acceptors such as ferricyanide or dichlorophenolindophenol (DCPIP) can provide information about the electron transfer capabilities of nuoK2 under different experimental conditions.

The choice of quinone substrates is critical when assessing nuoK2 activity. Based on studies of similar oxidoreductases, researchers should test a panel of quinones with varying structures to determine substrate preferences and kinetic parameters . For instance, ubiquinone (Q1), menadione, and 9,10-phenanthrenequinone often serve as good substrates for NADH-quinone oxidoreductases and provide valuable comparative data on enzymatic efficiency.

How does nuoK2 contribute to the superior nitrogen fixation efficiency observed in Sinorhizobium medicae compared to related species?

The superior nitrogen fixation efficiency of Sinorhizobium medicae WSM419 compared to strains like S. meliloti Sm1021 may be partially attributed to differences in energy metabolism involving nuoK2. Nitrogen fixation is an energetically demanding process requiring significant ATP and reducing power, which are generated through respiratory electron transport chains involving NADH-quinone oxidoreductases .

Comparative genomic and transcriptomic analyses suggest that nuoK2 in S. medicae WSM419 may exhibit enhanced electron transfer efficiency under the microaerobic conditions found in root nodules. This increased efficiency could contribute to:

  • Improved ATP production for nitrogenase activity

  • Better maintenance of redox balance during symbiotic nitrogen fixation

  • Enhanced adaptability to the acidic conditions often encountered in the rhizosphere

What is the role of nuoK2 in Sinorhizobium medicae's acid tolerance compared to other rhizobial species?

Sinorhizobium medicae WSM419 exhibits superior acid tolerance compared to many related rhizobial species, a trait crucial for successful colonization of acidic soils. Research suggests that NADH-quinone oxidoreductases, including nuoK2, may contribute to this acid tolerance through several mechanisms :

  • Maintenance of proton motive force: Under acidic conditions, nuoK2 and associated respiratory chain components may help maintain appropriate proton gradients across bacterial membranes, preventing cytoplasmic acidification.

  • Redox homeostasis: The electron transfer activity of nuoK2 contributes to cellular redox balance, which is particularly important under acid stress conditions where reactive oxygen species generation may increase.

  • Energy production for stress responses: The ATP generated through respiratory chains involving nuoK2 supports various acid-tolerance mechanisms, including proton pumping, synthesis of protective compounds, and maintenance of intracellular pH.

Comparative genomic analysis between S. medicae WSM419 and less acid-tolerant species reveals potential adaptations in the nuoK2 sequence that may optimize its function under acidic conditions . These adaptations could include modifications to proton-binding sites or structural elements that maintain protein stability at lower pH values.

What are the appropriate experimental designs for investigating nuoK2 involvement in detoxification pathways during host plant colonization?

Investigating nuoK2's role in detoxification during plant colonization requires carefully designed experiments that capture the complex interactions between S. medicae and host plants. The following experimental design approach is recommended:

  • Construction of nuoK2 mutants and complemented strains:

    • Generate precise deletion mutants (ΔnuoK2) using CRISPR-Cas9 or allelic exchange

    • Create complemented strains with wild-type nuoK2 under native promoter

    • Develop strains expressing tagged versions of nuoK2 for localization studies

  • Comparative phenotypic characterization:

    • Assess growth in presence of plant-derived quinones and phenolic compounds

    • Measure quinone reductase activity in wild-type vs. mutant strains

    • Determine survival rates under oxidative stress conditions that mimic plant defense responses

  • Plant colonization experiments:

    • Perform competitive nodulation assays between wild-type and ΔnuoK2 strains

    • Utilize fluorescently labeled strains for microscopic tracking during infection process

    • Analyze transcriptional responses of wild-type and mutant strains during root colonization

This experimental framework conforms to principles of rigorous experimental design, including appropriate controls, replication, and statistical analysis . When evaluating quinone detoxification specifically, researchers should consider using metabolomic approaches to track the transformation of plant-derived quinones by bacterial cells expressing different levels of nuoK2.

How can crystallographic analysis be optimized to resolve the structure of membrane-bound nuoK2 from Sinorhizobium medicae?

Obtaining high-resolution structural data for membrane-bound proteins like nuoK2 presents significant challenges. Based on successful approaches with similar proteins, the following methodology is recommended:

  • Protein production optimization:

    • Screen multiple constructs with varying N- and C-terminal boundaries

    • Test fusion partners that enhance crystallization (e.g., T4 lysozyme, BRIL)

    • Implement limited proteolysis to identify stable domains

    • Utilize insect cell or mammalian expression systems for complex membrane proteins

  • Crystallization strategies:

    • Employ lipidic cubic phase (LCP) crystallization for membrane proteins

    • Screen detergent:lipid ratios systematically

    • Use bicelles or nanodiscs to maintain native-like membrane environment

    • Apply surface entropy reduction mutations to enhance crystal contacts

  • Alternative structural approaches:

    • Cryo-electron microscopy for larger complexes containing nuoK2

    • NMR spectroscopy for dynamic analyses of specific domains

    • Molecular dynamics simulations based on homology models

The crystallographic approach should incorporate lessons from successful structural studies of related oxidoreductases, such as the PcQOR-NADPH complex resolved at 2.4 Å . Key features worth exploring include the NADH-binding groove and potential quinone-binding channels, which could be identified through computational simulation combined with site-directed mutagenesis.

How do transcriptional regulators modulate nuoK2 expression during different stages of symbiotic association with Medicago species?

Understanding the transcriptional regulation of nuoK2 during symbiosis requires a multi-faceted approach that captures temporal and spatial dynamics of gene expression. Based on similar studies in rhizobial systems, the following methodology is recommended:

  • Transcriptional profiling:

    • RNA-seq analysis of S. medicae during different stages of nodulation

    • Comparison of nuoK2 expression patterns across compatible and incompatible host interactions

    • Single-cell transcriptomics to capture cell-to-cell variation within nodule populations

  • Promoter analysis:

    • Identification of cis-regulatory elements in the nuoK2 promoter region

    • Construction of promoter-reporter fusions to track expression in planta

    • Chromatin immunoprecipitation (ChIP-seq) to identify transcription factors binding to the nuoK2 promoter

  • Regulatory network mapping:

    • Systematic analysis of nuoK2 expression in regulatory mutant backgrounds

    • Protein-DNA interaction studies to validate direct regulatory relationships

    • Integration of expression data with metabolomic profiles to identify metabolite-mediated regulation

This research approach can reveal how nuoK2 expression is coordinated with other symbiosis-related genes and metabolic processes during the establishment of efficient nitrogen-fixing nodules. The superior nitrogen fixation efficiency of S. medicae WSM419 compared to strains like S. meliloti Sm1021 may be partially attributed to differences in the regulation of key metabolic genes including nuoK2 .

How does nuoK2 function integrate with broader metabolic networks during symbiotic nitrogen fixation?

The integration of nuoK2 function within broader metabolic networks during symbiotic nitrogen fixation can be analyzed through systems biology approaches. Current understanding suggests several key interconnections:

NADH-quinone oxidoreductases like nuoK2 serve as critical nodes connecting carbon metabolism, electron transport, and nitrogen fixation. During symbiosis, plant-derived carbon compounds are metabolized through glycolysis and the TCA cycle, generating NADH that enters the electron transport chain via nuoK2 and related complexes .

A systems-level analysis reveals the following interconnections:

  • Redox balance maintenance: nuoK2 helps maintain the NADH/NAD+ ratio, which affects numerous metabolic pathways including nitrogen assimilation and carbon metabolism.

  • Energy coupling: The proton-pumping activity associated with nuoK2 contributes to the proton motive force that drives ATP synthesis, providing energy for nitrogenase activity and nutrient transport.

  • Oxygen management: By participating in respiratory electron transport, nuoK2 contributes to oxygen consumption, helping maintain the microaerobic environment required for nitrogenase function.

This systems perspective explains why alterations in nuoK2 can have far-reaching effects on symbiotic performance. Metabolic flux analysis and constraint-based modeling can further elucidate how nuoK2 activity influences global metabolic states during different stages of symbiosis .

What computational approaches are most effective for predicting substrate specificity of nuoK2 based on sequence and structural data?

Predicting substrate specificity of nuoK2 requires integrated computational approaches that leverage available sequence, structural, and functional data. Based on successful strategies applied to similar oxidoreductases, the following computational pipeline is recommended:

  • Homology modeling and molecular docking:

    • Generate homology models of nuoK2 based on structurally characterized quinone oxidoreductases

    • Perform molecular docking simulations with diverse quinone substrates

    • Calculate binding energies and identify key interaction residues

  • Sequence-based approaches:

    • Multiple sequence alignment of nuoK2 homologs with known substrate preferences

    • Identification of specificity-determining positions (SDPs) using statistical coupling analysis

    • Machine learning classification based on sequence features associated with substrate preference

  • Molecular dynamics simulations:

    • Simulate protein-substrate interactions in explicit membrane environments

    • Analyze water and proton dynamics in potential proton transfer pathways

    • Calculate free energy profiles for substrate binding and product release

This computational workflow has been successfully applied to related quinone oxidoreductases, revealing substrate-binding channels and catalytically important residues . For nuoK2, particular attention should be paid to residues lining putative quinone-binding sites, as these are likely to determine substrate specificity. Once predicted, these residues can be validated through site-directed mutagenesis and enzymatic assays measuring activity with different quinone substrates.

How might CRISPR-Cas9 genome editing be optimized for precise modification of nuoK2 in Sinorhizobium medicae?

Optimizing CRISPR-Cas9 genome editing for precise modification of nuoK2 in S. medicae requires addressing several technical challenges specific to rhizobial systems. Based on recent advances in bacterial genome editing, the following methodology is recommended:

  • Delivery system optimization:

    • Design broad-host-range vectors capable of stable maintenance in S. medicae

    • Optimize transformation protocols specific to S. medicae (e.g., electroporation parameters, recovery media)

    • Consider transient expression systems to minimize off-target effects

  • CRISPR-Cas9 component customization:

    • Test alternative Cas9 variants (e.g., high-fidelity Cas9) to minimize off-target effects

    • Optimize codon usage of Cas9 for efficient expression in S. medicae

    • Develop inducible or tissue-specific promoters for controlled expression

  • HDR template design:

    • Include extended homology arms (>500 bp) to enhance recombination efficiency

    • Incorporate silent mutations in PAM sites to prevent re-cutting

    • Design screening strategies to identify successful editing events

This approach can be used to create precise mutations in nuoK2 to test hypotheses about structure-function relationships, such as modifying residues involved in quinone binding or NADH interaction . The successful implementation of CRISPR-Cas9 editing in S. medicae would significantly accelerate functional studies of nuoK2 and other genes involved in symbiotic nitrogen fixation.

What are the prospects for engineering enhanced nuoK2 variants to improve nitrogen fixation efficiency in agricultural applications?

Engineering enhanced nuoK2 variants presents a promising approach to improving nitrogen fixation efficiency for agricultural applications. Based on current understanding of nuoK2 function and nitrogen fixation biochemistry, several engineering strategies can be considered:

  • Structure-guided protein engineering:

    • Modify residues in the quinone-binding site to enhance catalytic efficiency

    • Engineer variants with altered regulatory properties to maintain activity under stress conditions

    • Introduce mutations that improve protein stability in acidic soil environments

  • Directed evolution approaches:

    • Develop high-throughput screening methods to identify nuoK2 variants with enhanced electron transfer efficiency

    • Apply compartmentalized self-replication techniques to evolve variants with improved performance

    • Implement continuous evolution systems that select for variants supporting enhanced nitrogen fixation

  • Synthetic biology integration:

    • Redesign regulatory circuits controlling nuoK2 expression to optimize coordination with nitrogenase activity

    • Engineer metabolic pathways that channel electrons more efficiently through nuoK2 to support nitrogen fixation

    • Integrate nuoK2 modifications with other genetic improvements targeting holistic enhancement of symbiotic performance

The potential agricultural impact of such engineering is substantial, considering that biological nitrogen fixation contributes 25-90 million metric tons of nitrogen to agriculture annually, valued at over US$10 billion . Even modest improvements in fixation efficiency through nuoK2 engineering could significantly reduce dependency on synthetic nitrogen fertilizers, leading to economic and environmental benefits in agricultural systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.