Recombinant Sinorhizobium medicae Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sinorhizobium medicae Undecaprenyl-diphosphatase (uppP)

Recombinant Sinorhizobium medicae Undecaprenyl-diphosphatase (uppP) is a recombinant protein derived from the bacterium Sinorhizobium medicae, specifically strain WSM419, which is also known as Ensifer medicae. This enzyme plays a crucial role in bacterial cell wall synthesis by catalyzing the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, a carrier lipid essential for peptidoglycan synthesis .

Function and Importance

Undecaprenyl-diphosphatase (uppP) is an integral membrane protein involved in the bacterial cell wall biosynthesis pathway. It is essential for the recycling of the undecaprenyl carrier, allowing it to participate in multiple rounds of peptidoglycan synthesis. This enzyme is a potential target for antibacterial drugs because it is not present in humans, making it a selective target for inhibiting bacterial growth without affecting human cells .

Protein Characteristics

  • Species: Sinorhizobium medicae (strain WSM419) or Ensifer medicae.

  • Uniprot ID: A6UFC2.

  • Tag Information: The tag type is determined during the production process.

  • Storage Buffer: Tris-based buffer with 50% glycerol.

  • Storage Conditions: Store at -20°C or -80°C for extended storage. Repeated freezing and thawing is not recommended .

Research Findings

Research on Sinorhizobium medicae has highlighted its role in symbiotic nitrogen fixation with legume plants like Medicago truncatula. The proteome analysis of S. medicae reveals a complex metabolic profile, with significant emphasis on nitrogen fixation and carbohydrate metabolism during symbiosis .

Table: Key Features of Recombinant Sinorhizobium medicae Undecaprenyl-diphosphatase (uppP)

FeatureDescription
SpeciesSinorhizobium medicae (strain WSM419)
FunctionCatalyzes dephosphorylation of undecaprenyl pyrophosphate
Uniprot IDA6UFC2
Storage Conditions-20°C or -80°C
Amino Acid Sequence Length268 amino acids

Potential Applications

The recombinant Sinorhizobium medicae Undecaprenyl-diphosphatase (uppP) can be used in various applications, including:

  • Antibacterial Drug Development: As a target for inhibiting bacterial cell wall synthesis.

  • Biotechnology: In the study of bacterial cell wall biosynthesis pathways.

  • Protein Biochemistry: For understanding the structure-function relationships of integral membrane proteins.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment of your specific requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uppP; Smed_3536; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Sinorhizobium medicae (strain WSM419) (Ensifer medicae)
Target Names
uppP
Target Protein Sequence
MADQSIISALVLGLIEGLTEFIPVSSTAHVLLAGHFLGFRSPGNTFAVLIQLGAILAILL VYFQKLLSIALALPTSVRARRFVLSVLLAFLPAALIGAAAHGFIKSVLFETPMLICVVLI VGGIILYVIDRLPLTPRYTDVFDYPPSLALKIGLFQCLAMIPGTSRSGATIAGALLMGTD KRSAAEFSFFLAMPTMVGAFALDLYKNREALSIDDIGLIAAGFIAAFIAGIFVVRSLLDF VSHRGFTPFAIWRILVGTAGLVGLWLLG
Uniprot No.

Target Background

Function
This recombinant *Sinorhizobium medicae* Undecaprenyl-diphosphatase (UppP) catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sinorhizobium medicae uppP and what role does it play in bacterial cell wall biosynthesis?

Undecaprenyl diphosphate phosphatase (UPPP, also known as uppP) in Sinorhizobium medicae is a membrane-bound enzyme that catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP) . This conversion represents a crucial step in the bacterial cell wall peptidoglycan biosynthesis pathway.

The pathway proceeds as follows:

  • Farnesyl diphosphate (FPP) is produced by farnesyl diphosphate synthase (FPPS)

  • UPP is formed when FPP condenses with 8 additional IPP molecules in a reaction catalyzed by undecaprenyl diphosphate synthase (UPPS)

  • UPPP then converts UPP to UP

  • UP serves as a lipid carrier for peptidoglycan precursors

This process is essential for S. medicae's cell wall integrity during both free-living states and symbiotic relationships with legume hosts . UPPP inhibition disrupts peptidoglycan synthesis, making it an attractive target for antibacterial agents .

How does the genomic diversity of S. medicae populations affect uppP expression and function?

Population genomics studies of S. medicae isolates reveal considerable genomic diversity that may influence uppP expression and function. Analysis of local S. medicae populations has shown that homologous recombination affects polymorphism patterns differently across the genome, with the chromosome showing less impact than plasmids .

The S. medicae WSM 419 genome includes a chromosome and two plasmids (pSMED01 and pSMED02), with pSMED02 identified as a hotspot for insertions and deletions . While uppP is not specifically mentioned among the variable genes, the genomic context in which it exists could vary between strains, potentially affecting its regulation.

Additionally, different S. medicae isolates carry genes that confer various adaptations, including those involved in polysaccharide synthesis . Since polysaccharides and peptidoglycan synthesis are interconnected processes in the cell envelope, variation in these pathways could indirectly influence uppP activity or requirements.

Research examining strain-specific variations in uppP would need to consider these genomic diversity factors, as they may impact enzyme function, regulation, and response to inhibitors.

What methodological approaches are recommended for expressing and purifying recombinant S. medicae uppP?

Expressing and purifying active recombinant S. medicae uppP presents several challenges due to its nature as a membrane protein. Based on successful approaches with related bacterial UPPPs, the following methodological workflow is recommended:

  • Expression system selection: A fusion protein approach has proven effective for other UPPPs. The research indicates successful activity assays using "a fusion hybrid of E. coli UPPP with Haloarcula marismortui bacteriorhodopsin, which is active in detergent-based assays" .

  • Vector design: Incorporate appropriate tags (His-tag, etc.) for purification and potentially a fusion partner to enhance solubility and stability.

  • Expression conditions optimization:

    • Test multiple E. coli strains specialized for membrane protein expression

    • Evaluate various induction temperatures (16-30°C)

    • Optimize inducer concentration and induction duration

    • Consider supplementing with specific lipids that might stabilize the protein

  • Membrane extraction: Carefully optimize detergent selection, as different detergents can significantly affect UPPP activity. Detergents like n-dodecyl-β-D-maltopyranoside (DDM) or n-octyl-β-D-glucopyranoside (OG) are commonly used for membrane protein extraction.

  • Purification strategy: Employ a multi-step approach including:

    • Affinity chromatography (IMAC if His-tagged)

    • Size-exclusion chromatography

    • Ion-exchange chromatography if needed

  • Activity verification: Develop a reliable assay system to confirm that the purified protein retains enzymatic activity, potentially using approaches similar to those described for UPPP inhibitor screening .

This systematic approach addresses the typical challenges encountered with membrane proteins while providing the necessary quality control to ensure the recombinant protein is suitable for downstream applications.

How can researchers effectively design inhibitor screening assays for S. medicae uppP?

Designing effective inhibitor screening assays for S. medicae uppP requires careful consideration of the enzyme's membrane-bound nature and catalytic characteristics. Based on information from successful UPPP inhibitor studies, a comprehensive screening approach should include:

Primary screening assays:

  • Detergent-based enzymatic assays: Using purified recombinant S. medicae uppP or an appropriate fusion construct (similar to the E. coli UPPP-bacteriorhodopsin fusion mentioned in the research) . This approach allows for direct measurement of enzyme inhibition.

  • Dose-response evaluation: Testing potential inhibitors at multiple concentrations to generate IC50 values, similar to the approach used for bacitracin, which exhibited an IC50 of 32 μM against UPPP .

Secondary validation assays:

  • Growth inhibition assays: Testing promising compounds against living S. medicae cultures to assess correlation between enzyme inhibition and bacterial growth inhibition .

  • Synergy testing: Evaluating potential uppP inhibitors in combination with other cell wall biosynthesis inhibitors to identify synergistic effects. Research indicates that compounds inhibiting both UPPS and UPPP "acted synergistically with seven antibiotics known to target bacterial cell wall biosynthesis (a fractional inhibitory concentration index, FICI~0.35, on average)" .

  • Selectivity screening: Testing compounds against human cell lines to identify selective inhibitors with minimal cytotoxicity, as demonstrated in previous UPPP inhibitor research .

Assay considerations:

ParameterRecommendationRationale
Detergent selectionTest multiple options (DDM, OG, CHAPS)Critical for maintaining enzyme stability and activity
Buffer compositionOptimize pH, ionic strength, divalent cationsUPPP activity depends on specific buffer conditions
Substrate concentrationAt or near KmProvides optimal sensitivity for inhibitor detection
Temperature25-30°CBalance between enzyme stability and activity
ControlsBacitracin (known UPPP inhibitor)Validates assay performance

This comprehensive screening approach enables efficient identification and characterization of S. medicae uppP inhibitors while providing necessary validation steps to confirm specificity and efficacy.

What is the relationship between S. medicae uppP activity and symbiotic nitrogen fixation?

The relationship between S. medicae uppP activity and symbiotic nitrogen fixation represents a complex interplay between bacterial cell wall metabolism and symbiotic functionality. While the research doesn't directly address this relationship, we can extrapolate from available data on S. medicae bacteroid physiology and cell wall biosynthesis.

Proteome analysis of S. medicae WSM419 during free-living growth versus symbiotic bacteroid states revealed significant lifestyle-dependent protein expression differences. Among 3,215 identified proteins, 1,361 displayed "strong lifestyle bias" . This extensive metabolic reprogramming during symbiosis likely includes changes in cell wall metabolism pathways involving uppP.

The bacteroid differentiation process involves substantial cell remodeling, including potential cell wall modifications to accommodate:

  • The specialized intracellular environment within nodule cells

  • The metabolic demands of nitrogen fixation

  • The need for selective permeability to facilitate nutrient exchange

Importantly, bacteroids maintain "normal levels of proteins involved in amino acid biosynthesis, glycolysis or gluconeogenesis, and the pentose phosphate pathway" , suggesting that many core metabolic processes remain active. Cell wall biosynthesis, including uppP activity, is likely maintained but potentially modified to support bacteroid physiology.

The importance of proper cell wall biosynthesis during symbiosis is further supported by research showing that genes involved in polysaccharide synthesis, which are closely linked to cell wall formation, show "one of the highest average levels of divergence" in S. medicae populations . This suggests selective pressure on cell envelope components during symbiotic adaptation.

Future research specifically examining uppP expression, activity, and localization during symbiotic stages would provide valuable insights into its role in supporting nitrogen fixation.

What are the potential impacts of targeting S. medicae uppP on plant-microbe interactions?

Targeting S. medicae uppP with inhibitors presents complex implications for plant-microbe interactions that extend beyond simple bacterial growth inhibition. As uppP is essential for bacterial cell wall biosynthesis, its inhibition would affect multiple aspects of the Sinorhizobium-legume symbiosis:

Impact on symbiotic establishment:
Inhibiting uppP would likely disrupt the infection process, as rhizobial invasion of root hairs and progression through infection threads requires dynamic cell wall modifications. Research has shown that S. medicae populations exhibit significant variation in genes related to polysaccharide synthesis, which "influence several phenotypes including the host range of the bacteria" . This suggests that proper cell envelope formation, dependent on uppP activity, is critical for host specificity and successful colonization.

Effects on bacteroid differentiation:
The transformation from free-living rhizobia to nitrogen-fixing bacteroids involves extensive cellular remodeling. Proteomic analysis has revealed that 1,361 proteins show "strong lifestyle bias" between these states . Disruption of uppP during this transition would likely compromise bacteroid formation by preventing proper cell wall adaptations required for the symbiotic state.

Nitrogen fixation efficiency:
Even if bacteroids form, uppP inhibition could reduce nitrogen fixation effectiveness. The research indicates that bacteroids maintain "a relatively independent anabolic metabolism" , which would include cell wall maintenance processes. Compromised cell wall integrity could affect:

  • Oxygen protection for nitrogenase

  • Nutrient exchange with the plant host

  • Stability of the symbiosome membrane interface

Selective targeting possibilities:
The genomic diversity observed among S. medicae isolates suggests potential strain-specific variations in uppP that could be exploited for selective targeting. This could theoretically allow for inhibition of specific rhizobial strains while preserving beneficial ones, though this would require detailed structural and functional characterization of strain-specific uppP variants.

These complex effects highlight the need to carefully evaluate uppP-targeting compounds not only for antibacterial efficacy but also for their specific impacts on symbiotic processes and plant health.

How does the structure and function of S. medicae uppP compare to uppP enzymes in pathogenic bacteria?

Although the research doesn't provide direct structural comparisons between S. medicae uppP and pathogenic bacterial homologs, we can analyze functional and evolutionary considerations based on the available information.

Functional conservation and divergence:

  • The transitions between free-living and symbiotic states

  • The specialized bacteroid cell wall requirements during symbiosis

  • Different regulatory mechanisms aligned with their symbiotic lifecycle

Inhibitor response profiles:

Research on UPPP inhibitors demonstrates that compounds like bacitracin inhibit E. coli UPPP with an IC50 of 32 μM . Other compounds, particularly those with lipophilic, anionic properties that mimic the UPP substrate, also show inhibitory activity . These compounds exhibit antibacterial activity against various pathogens including:

  • Methicillin-resistant Staphylococcus aureus (MRSA)

  • Vancomycin-resistant Enterococci (VRE)

  • Bacillus anthracis

  • Listeria monocytogenes

The effectiveness of these inhibitors against S. medicae UPPP might differ due to potential structural variations in the active site or substrate binding pocket, particularly given S. medicae's adaptation to symbiotic lifestyles.

Genomic context considerations:

The genomic context of uppP also differs between S. medicae and pathogenic bacteria. S. medicae exhibits significant genomic diversity among strains, with evidence of horizontal gene transfer and "genes that may confer adaptations" being transferred between strains . This genomic plasticity might extend to uppP, potentially resulting in functional variations not observed in more specialized pathogens.

Understanding these comparative aspects would require:

  • Structural determination of S. medicae uppP

  • Comparative inhibitor screening against both S. medicae and pathogenic bacterial uppP enzymes

  • Detailed kinetic analyses to identify catalytic differences

Such studies would facilitate the development of inhibitors that could selectively target pathogenic bacteria while minimizing effects on beneficial symbionts.

What are the most promising approaches for determining the crystal structure of S. medicae uppP?

Determining the crystal structure of S. medicae uppP presents significant challenges due to its nature as a membrane protein. Based on advances in membrane protein structural biology and the specific characteristics of UPPP enzymes, the following approaches offer the most promising pathways:

1. Fusion protein crystallization strategy:

Research has demonstrated successful activity assays using "a fusion hybrid of E. coli UPPP with Haloarcula marismortui bacteriorhodopsin" . Expanding on this approach for crystallography:

  • Create fusion constructs with crystallization-promoting partners (T4 lysozyme, BRIL, etc.)

  • Engineer truncations to remove flexible regions while maintaining catalytic activity

  • Introduce specific point mutations to improve crystal packing without affecting function

2. Lipidic cubic phase (LCP) crystallization:

This method has revolutionized membrane protein crystallography and may be particularly suitable for S. medicae uppP:

  • Provides a native-like lipidic environment for the protein

  • Facilitates crystal contacts while maintaining protein stability

  • Allows for in meso crystallization trials with various detergents and lipids

3. Nanobody-assisted crystallography:

Developing nanobodies (single-domain antibody fragments) against S. medicae uppP could:

  • Stabilize specific conformations of the enzyme

  • Provide additional crystal contact surfaces

  • Reduce conformational heterogeneity that might prevent crystallization

4. Complementary approaches:

ApproachAdvantagesConsiderations
Cryo-electron microscopyNo crystallization required; captures different conformational statesMay require larger protein complexes for adequate resolution
NMR spectroscopyProvides dynamic information in solutionSize limitations; requires stable isotope labeling
Molecular dynamics simulationsCan predict structure based on homology modelsRequires experimental validation
AlphaFold2/RoseTTAFold predictionIncreasingly accurate for membrane proteinsStill benefits from experimental validation

5. Structure-function validation:

Once structural data is obtained, validation through site-directed mutagenesis of predicted catalytic residues and inhibitor binding sites would be essential, with mutants tested using the enzymatic assays described in the UPPP inhibitor research .

This multi-faceted approach maximizes the chances of successfully determining the S. medicae uppP structure, providing critical insights for understanding its catalytic mechanism and facilitating structure-based inhibitor design.

What are the most effective assays for measuring S. medicae uppP activity in vitro?

Developing robust assays for S. medicae uppP activity requires addressing the challenges associated with membrane protein enzymology while maintaining physiological relevance. Based on successful approaches with related UPPPs, the following assay systems are recommended:

Primary enzymatic assays:

  • Phosphate release assay:

    • Measure inorganic phosphate released during UPP dephosphorylation

    • Use colorimetric methods (malachite green or molybdate-based)

    • Advantages: Simple, quantitative, amenable to high-throughput screening

    • Limitations: Potential interference from phosphate contaminants

  • Coupled enzyme assays:

    • Link UPPP activity to NADH oxidation through auxiliary enzymes

    • Monitor absorbance decrease at 340 nm

    • Advantages: Continuous monitoring, high sensitivity

    • Limitations: Multiple enzymes increase complexity and potential for artifacts

  • Radiolabeled substrate assay:

    • Use 32P-labeled UPP substrate

    • Measure conversion to UP by thin-layer chromatography

    • Advantages: Direct measurement, high sensitivity

    • Limitations: Requires radioisotope handling, not high-throughput

Assay optimization considerations:

The research on UPPP inhibitors indicates that specific conditions are critical for reliable activity measurements . Key parameters include:

  • Detergent selection: Crucial for maintaining enzyme stability while allowing substrate access

  • Lipid composition: Addition of specific phospholipids may enhance activity by mimicking the native membrane environment

  • pH optimization: Systematic testing to determine pH optimum for S. medicae uppP

  • Divalent cation requirements: Testing Mg2+, Mn2+, or Ca2+ dependencies

  • Temperature: Balancing optimal activity with protein stability

Validation approaches:

  • Known inhibitor response: Confirm that the assay shows expected inhibition with bacitracin (IC50 = 32 μM for related UPPP)

  • Substrate kinetics: Establish Km and Vmax parameters to ensure assays are conducted at appropriate substrate concentrations

  • Mutant controls: Use catalytically inactive mutants as negative controls

These assay systems provide complementary approaches for comprehensive characterization of S. medicae uppP activity, enabling both mechanistic studies and inhibitor screening applications.

How can site-directed mutagenesis be used to understand the catalytic mechanism of S. medicae uppP?

Site-directed mutagenesis represents a powerful approach for elucidating the catalytic mechanism of S. medicae uppP. Based on general principles of phosphatase enzymology and information about bacterial UPPP function, the following systematic mutagenesis strategy would provide valuable mechanistic insights:

1. Identification and mutation of putative catalytic residues:

Focus on conserved residues likely involved in:

  • Phosphate coordination (arginine, lysine residues)

  • Metal ion binding (aspartate, glutamate, histidine)

  • Nucleophilic attack (serine, threonine, cysteine)

  • Proton donation/acceptance (histidine, glutamate)

2. Substrate binding site investigation:

Create mutations in the predicted substrate binding pocket to probe:

  • Lipid chain interactions (hydrophobic residues)

  • Pyrophosphate group coordination (positively charged residues)

  • Substrate orientation determinants

3. Membrane interface exploration:

Mutate residues predicted to interact with the lipid bilayer to understand:

  • How membrane association affects catalysis

  • Whether the membrane serves as part of the substrate binding surface

  • If conformational changes occur at the membrane interface

4. Systematic mutagenesis strategy:

Mutation typePurposeExamples
Alanine scanningRemove side chain function without major structural disruptionReplace conserved charged residues with alanine
Conservative substitutionsMaintain similar properties while subtly altering functionAsp→Glu, Lys→Arg, Ser→Thr
Charge reversalDrastically alter electrostatic propertiesAsp→Lys, Lys→Glu
Cysteine substitutionEnable chemical modification for accessibility studiesReplace various residues with cysteine for subsequent labeling

5. Functional characterization of mutants:

Each mutant should be analyzed for:

  • Expression and stability

  • Substrate binding affinity

  • Catalytic efficiency (kcat/Km)

  • pH-activity profile changes

  • Metal dependence alterations

  • Inhibitor sensitivity

6. Integration with structural information:

Combine mutagenesis results with:

  • Homology models based on related UPPPs

  • Structural predictions from AlphaFold2 or similar tools

  • Crystallographic data if available

  • Molecular dynamics simulations

This comprehensive mutagenesis approach would map the functional architecture of S. medicae uppP, revealing how this enzyme catalyzes the essential dephosphorylation of UPP and potentially identifying unique features that distinguish it from homologs in other bacterial species.

What are the key considerations for developing selective inhibitors of S. medicae uppP?

Developing selective inhibitors of S. medicae uppP for research applications requires balancing potency, selectivity, and physicochemical properties. Based on information from successful UPPP inhibitor development , the following considerations are essential:

1. Structure-based design approach:

The research indicates that effective UPPP inhibitors often share certain structural features:

  • Lipophilic, anionic properties that mimic the UPP substrate

  • Benzoic acid derivatives show particular promise, with compounds such as "5-fluoro-2-(3-(octyloxy)benzamido)benzoic acid" demonstrating potent activity (ED50 ~0.15 μg/mL)

  • Balance between hydrophobic elements (for membrane interaction) and charged groups (for active site binding)

2. Selectivity considerations:

Developing S. medicae-selective uppP inhibitors requires:

  • Comparative screening against uppP from multiple bacterial species

  • Counter-screening against human enzymes to minimize toxicity

  • Assessment of effects on related phosphatases/dephosphorylases

3. Physicochemical property optimization:

PropertyTarget rangeRationale
Lipophilicity (LogP)2-5Balance membrane penetration with solubility
Molecular weight<500 DaFacilitate membrane permeability
Topological polar surface area75-150 ŲOptimize membrane interaction
Metabolic stabilityT1/2 >60 min in liver microsomesEnsure sufficient duration of action

4. Assay cascade for inhibitor development:

A comprehensive screening approach should include:

  • Primary biochemical assay against purified S. medicae uppP

  • Counter-screening against related bacterial UPPPs to identify selective compounds

  • S. medicae growth inhibition assessment

  • Cytotoxicity evaluation against mammalian cells

  • Effect on symbiosis establishment in plant-microbe model systems

5. Synergy evaluation:

The research highlights that UPPP inhibitors "acted synergistically with seven antibiotics known to target bacterial cell wall biosynthesis (a fractional inhibitory concentration index, FICI~0.35, on average)" . This suggests that combination approaches could enhance efficacy and potentially reduce resistance development.

6. Optimization for research applications:

For research tools, additional properties might be desirable:

  • Photoaffinity labeling capability for target engagement studies

  • Fluorescent or radiolabeled derivatives for localization studies

  • Immobilizable versions for pull-down experiments

By systematically addressing these considerations, researchers can develop selective S. medicae uppP inhibitors that serve as valuable tools for investigating this enzyme's role in bacterial physiology and symbiotic relationships.

How might genomic diversity in S. medicae populations impact uppP inhibitor effectiveness?

The genomic diversity observed in S. medicae populations has significant implications for uppP inhibitor development and efficacy. Research on S. medicae isolates reveals substantial genetic variation that could directly influence how these bacteria respond to uppP-targeting compounds.

Population genomics studies of S. medicae have identified considerable polymorphism patterns across the genome, with different evolutionary forces shaping variation in the chromosome versus plasmids . The chromosome shows relatively low sequence polymorphism, "consistent with the high density of housekeeping genes" . If the uppP gene is located on the chromosome (as are many essential metabolic genes), it might show conservation across strains, potentially making it a stable drug target.

  • Horizontal gene transfer capacity: S. medicae populations show evidence of gene transfer between strains, with certain gene clusters being "co-distributed, suggesting that they may be on the same mobile element" . If uppP variants or resistance determinants can be horizontally transferred, this could facilitate rapid spread of resistance.

  • Strain-specific adaptations: Different S. medicae isolates carry genes that "may confer adaptations that S. medicae WSM 419 lacks" . Some of these adaptations might include alternative pathways or compensatory mechanisms that reduce dependency on uppP activity.

  • Variable selection pressures: The research notes that "different selection" may explain the varying levels of polymorphism in different gene classes . The symbiotic lifestyle may impose unique selection pressures on cell wall biosynthesis genes like uppP.

The practical implications for inhibitor development include:

ConsiderationImpact on inhibitor developmentMitigation strategy
Sequence variation in uppPPotential strain-specific responses to inhibitorsTarget highly conserved regions of the enzyme
Alternative metabolic pathwaysPossible bypass mechanisms reducing inhibitor effectivenessDevelop combination approaches targeting multiple pathways
Horizontal gene transferRapid spread of resistance mechanismsIdentify and counter-target resistance determinants
Population heterogeneityVariable efficacy across strainsTest candidate inhibitors against diverse strain panels

Understanding this genomic diversity context is essential for developing uppP inhibitors with broad efficacy across S. medicae populations and for predicting potential resistance mechanisms before they emerge in response to selective pressure.

What techniques can be used to study the dynamics of uppP activity during the transition from free-living to bacteroid states?

Investigating the dynamics of uppP activity during the transition from free-living S. medicae to symbiotic bacteroids requires sophisticated techniques that can capture changes in enzyme expression, localization, and function. Based on the research on S. medicae bacteroid proteomics and general approaches in symbiosis research, the following methodological framework is recommended:

1. Temporal expression analysis:

Proteomics approaches similar to those described in the research, which identified 3,215 proteins with 1,361 showing "strong lifestyle bias" , can be extended to specifically track uppP expression:

  • Tandem mass spectrometry (MS/MS) with improved sensitivity for membrane proteins

  • Targeted proteomics (MRM/PRM) for absolute quantification of uppP

  • Time-course sampling during nodule development stages

2. Transcriptional regulation analysis:

  • RNA-seq to measure uppP transcript levels during symbiotic progression

  • Chromatin immunoprecipitation (ChIP-seq) to identify transcription factors regulating uppP

  • Promoter-reporter fusions to visualize uppP expression patterns in planta

3. Enzyme activity measurements:

TechniqueApplicationAdvantages
Activity-based protein profilingLabel active uppP in situDistinguishes active enzyme from inactive forms
In situ enzyme assaysMeasure uppP activity in nodule sectionsPreserves spatial context
Ex vivo activity measurementsExtract bacteroids for direct enzyme assaysAllows controlled reaction conditions

4. Localization studies:

  • Fluorescent protein fusions to track uppP localization during differentiation

  • Immunogold electron microscopy for high-resolution localization

  • Super-resolution microscopy to examine membrane distribution patterns

5. Genetic approaches:

  • Conditional mutants to modulate uppP expression at different symbiotic stages

  • Site-directed mutagenesis to create catalytically inactive versions for dominant-negative effects

  • CRISPR interference for temporal suppression of uppP expression

6. Metabolic impact assessment:

The research indicates that bacteroids maintain "normal levels of proteins involved in amino acid biosynthesis, glycolysis or gluconeogenesis, and the pentose phosphate pathway" . To understand how uppP activity relates to these metabolic patterns:

  • Metabolomics profiling of cell wall precursors

  • Peptidoglycan composition analysis at different developmental stages

  • Isotope labeling to track cell wall synthesis rates

This integrated approach would provide comprehensive insights into how uppP activity changes during bacteroid differentiation, revealing its role in the cell wall modifications that accompany symbiotic adaptation and potentially identifying stage-specific regulatory mechanisms that could be exploited for targeted intervention.

What are the most significant open questions regarding S. medicae uppP that merit further investigation?

Despite advances in understanding bacterial undecaprenyl-diphosphatases and S. medicae biology, several critical questions about S. medicae uppP remain unanswered. These knowledge gaps represent valuable opportunities for future research with implications for both basic science and applied biotechnology.

The most significant open questions include:

  • Structural characterization: How does the three-dimensional structure of S. medicae uppP compare to homologs from other bacteria, particularly pathogens? This fundamental question underlies many others, as structural insights would facilitate understanding of catalytic mechanisms, inhibitor design, and evolutionary adaptations.

  • Symbiotic regulation: How is uppP activity regulated during the transition from free-living to bacteroid states? While proteomics research has identified 1,361 proteins with "strong lifestyle bias" , the specific regulation of uppP during symbiosis remains uncharacterized.

  • Cell wall modifications: What role does uppP play in the cell wall remodeling that occurs during bacteroid differentiation? The relationship between uppP activity and the specialized peptidoglycan structure of bacteroids requires investigation.

  • Metabolic integration: How is uppP activity coordinated with other aspects of S. medicae metabolism? The research indicates that bacteroids maintain "relatively independent anabolic metabolism" , but the integration of cell wall biosynthesis with nitrogen fixation metabolism is poorly understood.

  • Inhibitor specificity determinants: What structural features of S. medicae uppP could be exploited to develop selective inhibitors? Understanding the unique aspects of this enzyme compared to pathogenic bacterial homologs could enable the development of tools that specifically interrupt symbiosis without broader antibacterial effects.

  • Genomic context effects: How does the genomic diversity observed in S. medicae populations influence uppP function and regulation? The relationship between uppP variants and the broader adaptive genomic context requires exploration.

  • Host plant interactions: Do plant-derived factors directly influence uppP activity during symbiosis? The possibility that host legumes might modulate bacterial cell wall metabolism as part of symbiotic development has not been thoroughly investigated.

Addressing these questions would significantly advance our understanding of this essential enzyme's role in both bacterial physiology and symbiotic relationships, potentially opening new avenues for interventions in agricultural and biomedical contexts.

How could advances in understanding S. medicae uppP contribute to sustainable agriculture practices?

Deeper understanding of S. medicae uppP has potential to contribute significantly to sustainable agriculture through several interconnected pathways. The rhizobium-legume symbiosis represents one of nature's most important nitrogen-fixing systems, and targeted manipulation of this relationship could yield substantial benefits for agricultural sustainability.

Enhanced symbiotic efficiency:
Research on S. medicae proteome differences between free-living cells and bacteroids has revealed extensive metabolic reprogramming during symbiosis, with 1,361 proteins showing "strong lifestyle bias" . Understanding uppP's role in this transition could enable:

  • Development of rhizobial inoculants with optimized cell wall properties for more efficient nodulation

  • Identification of plant breeding targets that better accommodate rhizobial cell wall adaptations

  • Creation of biostimulants that specifically enhance the symbiotic transition process

Improved strain specificity:
Population genomics studies of S. medicae have identified considerable genomic diversity among strains . This understanding could facilitate:

  • Selection of optimal S. medicae strains with uppP variants that provide superior symbiotic performance

  • Development of competition-enhancing treatments that give beneficial inoculants an advantage over less effective indigenous strains

  • Creation of molecular tools to accurately track strain persistence and performance in field settings

Precision agriculture applications:

Potential applicationMechanismSustainability benefit
Targeted symbiosis modulatorsCompounds that specifically interact with uppP to enhance nodulationReduced synthetic nitrogen fertilizer requirements
Diagnostic toolsMolecular probes for uppP variants to assess rhizobial community compositionImproved monitoring of soil health and symbiotic potential
Selective biostimulantsCompounds that enhance uppP activity during early infection stagesMore reliable nodulation under environmental stress conditions

Environmental stress adaptation:
Understanding how uppP functions under various environmental conditions could help develop rhizobial strains with enhanced tolerance to stresses likely to increase with climate change:

  • Drought tolerance through optimized cell wall properties

  • Temperature stress resistance through stabilized cell envelope structure

  • Soil acidity adaptation through modified peptidoglycan composition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.