Recombinant Sinorhizobium medicae UPF0283 membrane protein Smed_1530 (Smed_1530)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped on blue ice unless dry ice shipping is specifically requested and approved in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Smed_1530; UPF0283 membrane protein Smed_1530
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Sinorhizobium medicae (strain WSM419) (Ensifer medicae)
Target Names
Smed_1530
Target Protein Sequence
MNDDSNGRRRRPAAFPVGTEDATSRELEQTPRRAPGSFSDKIVMTPDADDPFIETTAAIE ALNPPEARPPRRRLSFGKIAAGAFGILISLAVGLWVDRLVRDLFSRADWLGYGAVAVVAI GAAAFLIVVAREIFGMMQLTAVQALKADLAAAAVAGKAQAARAATARLVHLLAGNPRTAK GRARLADTEGEIIDAPHLVDLTERELLAPLDREARRIILGAAKRVSIVTAVSPRALVDLG YVLYESARMIRAMAELYGGRPGTLGLLRLMRDVVAHLAVTGSIAVGDSLVQQILGHGLAS KLSARLGEGVINGLMTARIGIAAMDLCRPMPFRALKRPSIGDFLADLAPGAGRTESATGK A
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of Smed_1530 within the S. medicae genome?

Smed_1530 is encoded within the genome of Sinorhizobium (Ensifer) medicae strain WSM419, which was originally isolated from Medicago murex nodules in 1981. The complete genome of S. medicae WSM419 consists of multiple replicons, including a chromosome and megaplasmids similar to the tripartite structure observed in related species like S. meliloti WSM1022. The genomic organization provides important context for understanding the evolutionary and functional significance of Smed_1530.

When investigating the genomic context, researchers should:

  • Examine flanking genes to identify potential operons

  • Compare synteny with related rhizobial species

  • Analyze promoter regions for regulatory elements

  • Investigate horizontal gene transfer signatures

The genomic position of Smed_1530 can provide insights into its potential role in symbiotic nitrogen fixation, particularly given that S. medicae WSM419 demonstrates high efficiency in nitrogen fixation with Medicago truncatula compared to less efficient strains like S. meliloti Sm1021 .

How does Smed_1530 compare structurally with other UPF0283 membrane proteins?

As a UPF0283 family membrane protein, Smed_1530 likely shares conserved structural features with other members of this protein family across bacterial species. Comparative structural analysis is essential for generating hypotheses about its function.

Table 1: Predicted Structural Features of Smed_1530 Compared to Related UPF0283 Proteins

FeatureSmed_1530UPF0283 Family AverageMethodology
Transmembrane domainsMultiple predicted3-5 TMDs typicalTMHMM/Phobius prediction
TopologyN-in/C-out predictedVariableTopCons consensus approach
Conserved motifs[Specific motifs][Family motifs]MEME/GLAM2 analysis
Secondary structureα-helical TMDsPredominantly α-helicalPSIPRED/JPred

The structural analysis of membrane proteins presents unique challenges compared to soluble proteins. Modern approaches combining AI-based structure prediction tools like AlphaFold2 with experimental validation can provide more accurate insights into Smed_1530's structure .

What is the predicted function of Smed_1530 based on sequence homology?

  • Perform sensitive sequence homology searches using PSI-BLAST and HHpred

  • Identify conserved domains and their known functions in other systems

  • Examine genomic neighborhood for functional context

  • Consider structural homology even in the absence of sequence homology

The efficient nitrogen fixation capability of S. medicae WSM419 compared to other strains suggests that unique proteins like Smed_1530 may contribute to its symbiotic effectiveness with Medicago species .

What strategies can overcome expression challenges for recombinant Smed_1530?

Membrane protein expression presents significant challenges, particularly for proteins like Smed_1530 that may have multiple transmembrane domains.

Expression optimization approaches:

  • Host selection: While E. coli is commonly used, consider specialized strains (C41/C43) designed for membrane protein expression

  • Codon optimization: Analyze the codon usage in Smed_1530 and optimize for the expression host to address potential rare codon clusters

  • Fusion tags: Test N- and C-terminal fusion partners (MBP, SUMO, Mistic) to improve folding and solubility

  • Expression conditions: Systematically optimize temperature, inducer concentration, and duration

For membrane proteins like Smed_1530, hydrophobicity analysis is critical as excessively hydrophobic regions can impede expression. Consider using fusion tags at both termini to distinguish full-length proteins from truncated products by increasing imidazole concentration during elution .

How can researchers establish the topology of Smed_1530 in the membrane?

Determining the precise topology of Smed_1530 is essential for understanding its function within the bacterial membrane.

Experimental approaches to topology mapping:

  • Cysteine scanning mutagenesis: Introduce cysteine residues at predicted loop regions and assess accessibility with thiol-reactive reagents

  • GFP fusion analysis: Create fusions at different positions and use fluorescence to determine cytoplasmic vs. periplasmic orientation

  • Protease protection assays: Use proteases that cannot cross membranes to determine exposed regions

  • Epitope insertion: Insert epitope tags at predicted loops and detect using antibodies

When comparing computational predictions with experimental results, researchers should be aware that predictions for multi-TMD proteins can be less accurate. The lateral gate mechanism described for SecY might be relevant for understanding Smed_1530 insertion .

What purification strategy is optimal for structural studies of Smed_1530?

Obtaining pure, stable, and correctly folded Smed_1530 is essential for structural characterization.

Recommended purification workflow:

  • Detergent screening: Test multiple detergents (DDM, LMNG, LDAO) for optimal extraction while maintaining native structure

  • Purification steps:

    • IMAC (Immobilized Metal Affinity Chromatography) using His-tag

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

  • Stability assessment: Monitor protein stability in different buffers using thermal shift assays

  • Reconstitution options: Consider nanodiscs or liposomes for functional studies

For challenging membrane proteins like Smed_1530, the MNP (Membrane Nanoparticle) platform may be beneficial as it extracts high-purity nanoscale cell membrane particles while maintaining the conformation and activity of membrane proteins .

How does Smed_1530 insertion compare between Oxa1 and SecY pathways?

Understanding the biogenesis of Smed_1530 requires knowledge of its membrane insertion mechanism. Based on current models of membrane protein biogenesis:

  • Oxa1 pathway suitability: This pathway typically inserts TMDs flanked by short translocated segments

  • SecY pathway suitability: This channel handles TMDs flanked by long translocated segments

  • Hybrid insertion mechanisms: Some complex membrane proteins utilize both pathways

The insertion of Smed_1530 likely depends on the length of translocated loops between its TMDs. If Smed_1530 has TMDs separated by short loops, it may preferentially use the Oxa1 pathway, whereas longer hydrophilic segments would require SecY-mediated translocation .

What approaches can identify potential interaction partners of Smed_1530?

Understanding protein-protein interactions is crucial for elucidating Smed_1530's function in S. medicae.

Interaction mapping methods:

  • Co-immunoprecipitation: Use tagged Smed_1530 to pull down interaction partners, followed by mass spectrometry identification

  • Bacterial two-hybrid assays: Adapt for membrane protein analysis

  • Crosslinking mass spectrometry: Use bifunctional crosslinkers to capture transient interactions

  • Proximity labeling: Employ BioID or APEX2 fusions to identify neighboring proteins in vivo

When analyzing potential interactions, researchers should consider the relationship between Smed_1530 and proteins involved in nitrogen fixation, given the high efficiency of S. medicae WSM419 in symbiotic nitrogen fixation with Medicago species .

How can researchers generate and validate Smed_1530 knockout mutants?

Creating and characterizing knockout mutants is essential for understanding Smed_1530's physiological role.

Knockout strategy workflow:

  • Design: Create gene replacement constructs with antibiotic resistance markers

  • Delivery: Use electroporation or conjugation to introduce the construct

  • Selection: Screen for double crossover events using positive/negative selection

  • Verification: Confirm gene deletion by PCR and sequencing

  • Complementation: Reintroduce the wild-type gene to confirm phenotype specificity

Table 2: Phenotypic Assays for Smed_1530 Mutant Characterization

PhenotypeAssay MethodExpected Outcome if Involved
Growth rateGrowth curvesReduced growth in specific media
Nodulation efficiencyPlant infection assaysAltered nodulation kinetics
Nitrogen fixationAcetylene reductionReduced nitrogen fixation activity
Membrane integrityMembrane permeability testsIncreased sensitivity to stressors
Protein localizationImmunofluorescenceMislocalization of partner proteins

The comparison between WSM419 wild-type and Smed_1530 knockout strains should focus on symbiotic properties, given that WSM419 demonstrates high nitrogen fixation efficiency with Medicago truncatula .

What computational approaches can predict Smed_1530 function?

When experimental data is limited, computational approaches can generate testable hypotheses about protein function.

Computational prediction pipeline:

  • Evolutionary analysis:

    • Phylogenetic profiling to identify co-evolving genes

    • Ancestral sequence reconstruction to identify conserved residues

    • Positive selection analysis to identify functionally important sites

  • Structural bioinformatics:

    • Binding site prediction using algorithms like FTSite or COACH

    • Molecular docking to identify potential ligands

    • Molecular dynamics simulations to examine conformational changes

  • Systems biology approaches:

    • Gene neighborhood analysis across multiple genomes

    • Co-expression network analysis from transcriptomic data

    • Metabolic pathway analysis for functional context

The future of membrane protein research will benefit from improved AI-based prediction tools like AlphaFold2, particularly for multi-domain proteins and protein complexes .

How does Smed_1530 differ between S. medicae WSM419 and S. meliloti strains?

Comparing Smed_1530 homologs between closely related Sinorhizobium species can provide insights into its potential role in host specificity and symbiotic efficiency.

Comparative analysis approach:

  • Sequence alignment: Identify conserved and variable regions between homologs

  • Structural modeling: Compare predicted structural differences

  • Genomic context: Analyze gene neighborhood conservation

  • Expression patterns: Compare transcriptomic data during symbiosis

S. medicae WSM419 and S. meliloti WSM1022 both demonstrate high efficiency in nitrogen fixation with Medicago truncatula (over 80% shoot growth compared to N-fed controls), while S. meliloti Sm1021 shows suboptimal efficiency (less than 40% shoot growth). These efficiency differences may correlate with variations in key membrane proteins like Smed_1530 .

What experimental approaches can determine if Smed_1530 is involved in symbiotic nitrogen fixation?

Given the importance of nitrogen fixation in rhizobial-legume symbiosis, investigating Smed_1530's potential role requires specialized approaches.

Experimental strategy:

  • Expression analysis: Quantify Smed_1530 expression during different stages of symbiosis using RT-qPCR

  • Localization studies: Use fluorescent protein fusions to track Smed_1530 localization in nodules

  • Interaction mapping: Identify potential interactions with known symbiosis proteins

  • Plant phenotyping: Evaluate the impact of Smed_1530 mutations on plant growth parameters

The comparison should focus on high-efficiency strains (WSM419 and WSM1022) versus low-efficiency strains (Sm1021) to identify correlations between Smed_1530 variants and nitrogen fixation capacity .

What are the optimal conditions for crystallization trials of Smed_1530?

Determining the three-dimensional structure of Smed_1530 through X-ray crystallography requires carefully optimized conditions.

Crystallization optimization workflow:

  • Sample preparation:

    • Purify to >95% homogeneity with minimal detergent

    • Concentrate to 5-15 mg/mL depending on stability

    • Remove flexible regions that may impede crystallization

  • Screening strategy:

    • Initial sparse matrix screens specialized for membrane proteins

    • Detergent screening (type and concentration)

    • Lipid cubic phase trials for challenging cases

    • Utilize thermal stability data to guide buffer optimization

  • Crystal optimization:

    • Fine-tune pH, precipitant concentration, and temperature

    • Consider antibody fragments or nanobodies as crystallization chaperones

    • Test additive screens to improve crystal quality

The challenges in membrane protein crystallization reflect the difficulties observed in transmembrane protein research, where hydrophobicity and stability are major concerns .

How can cryo-EM be utilized for structural determination of Smed_1530?

For membrane proteins that resist crystallization, cryo-electron microscopy offers an alternative structural determination method.

Cryo-EM workflow for Smed_1530:

  • Sample preparation:

    • Reconstitute in nanodiscs or amphipols to eliminate detergent

    • Optimize protein concentration and ice thickness

    • Consider adding mass through fusion partners if protein is small

  • Data collection strategy:

    • Use energy filters to improve contrast

    • Collect tilt series to address preferred orientation issues

    • Implement beam-induced motion correction

  • Image processing:

    • Particle picking with reference-free approaches

    • 2D and 3D classification to separate conformational states

    • Use focused refinement for flexible regions

The integration of AI-based structure prediction with experimental cryo-EM data represents a powerful approach for membrane protein structure determination, particularly relevant as technologies like AlphaFold2 continue to improve .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.