Recombinant Sistrurus miliarius NADH-ubiquinone oxidoreductase chain 4 (MT-ND4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4; MTND4; NADH4; ND4; NADH-ubiquinone oxidoreductase chain 4; NADH dehydrogenase subunit 4; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Sistrurus miliarius (Pigmy rattlesnake) (Crotalus miliarius)
Target Names
Target Protein Sequence
PIAGSMILAAILLKLGGYGIIRLMQIFPTTKTDVFLPFIVLALWGAILANLTCLQQTDLK SLIAYSSISHMGLVVAAIIIQTPWGLSGAMALMIAHGFTSSALFCLANTTYERTHTRILI LTRGLHNMMPMATTWWLMANLMNIAIPPSMNFTGELLILSTLFNWCPTTIIMLGLSMLIT ASYSLHMFLSTQMGPTLINNLTEPTHSREHLLMTLHLIPLLMISFKPELVT
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) is believed to be part of the minimal assembly required for catalysis. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Protein Families
Complex I subunit 4 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4 and what is its biological function?

MT-ND4 (mitochondrial NADH-ubiquinone oxidoreductase chain 4) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase, commonly known as Complex I. This transmembrane protein plays a crucial role in cellular energy production by catalyzing electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. The protein is essential for both the catalytic activity and proper assembly of Complex I, making it integral to mitochondrial function and cellular metabolism . In Sistrurus miliarius (Pygmy rattlesnake), this protein is encoded by the mitochondrial genome, highlighting its evolutionary conservation across diverse species and its fundamental importance in energy metabolism.

How should recombinant MT-ND4 be stored to maintain optimal activity?

For optimal stability and activity maintenance, recombinant Sistrurus miliarius MT-ND4 should be stored at -20°C for regular use, or at -80°C for extended storage periods . The protein is typically supplied in a storage buffer containing Tris-based components with 50% glycerol, which has been optimized to maintain protein stability. It is important to avoid repeated freeze-thaw cycles as these can significantly reduce protein activity and integrity. For working solutions, aliquots can be maintained at 4°C for up to one week . When planning experiments, researchers should consider preparing single-use aliquots to minimize degradation and ensure consistent experimental results across multiple studies.

What expression systems are used to produce recombinant MT-ND4?

Recombinant Sistrurus miliarius MT-ND4 is typically produced using in vitro E. coli expression systems . The protein is often expressed with affinity tags, such as an N-terminal 10xHis-tag, to facilitate purification . Alternative expression systems include wheat germ-based cell-free systems, which have been successfully employed for the expression of similar proteins like human ND4 . The choice of expression system impacts protein folding, post-translational modifications, and ultimately the functional characteristics of the recombinant protein. For membrane proteins like MT-ND4, specialized expression conditions may be necessary to ensure proper folding and maintain the native conformation of this hydrophobic transmembrane protein.

What are the optimal conditions for detecting MT-ND4 using Western blotting?

For effective Western blot detection of recombinant Sistrurus miliarius MT-ND4, researchers should use SDS-PAGE with 12.5% gels, which provide optimal resolution for proteins in the 30-55 kDa range . When the protein contains epitope tags such as HA1, antibodies against these tags can be used for specific detection, resulting in a signal with an apparent molecular mass of approximately 54 kDa . For untagged proteins, specific anti-MT-ND4 antibodies must be employed. Sample preparation should include careful optimization of solubilization conditions, as MT-ND4 is a transmembrane protein that may aggregate during the denaturation process. A transfer buffer containing 20% methanol with 0.1% SDS is recommended for efficient transfer of this hydrophobic protein to PVDF or nitrocellulose membranes, followed by blocking with 5% non-fat dry milk or BSA solution to minimize background signal.

How can researchers assess the functional activity of recombinant MT-ND4?

Functional assessment of recombinant MT-ND4 requires analysis of its integration into Complex I and subsequent effect on electron transport chain activity. This can be accomplished through multiple complementary approaches:

The gold standard approach involves reconstitution experiments where recombinant MT-ND4 is introduced into systems with deficient or mutated endogenous protein, followed by assessment of rescued Complex I activity . Researchers should include appropriate positive and negative controls and normalize results to account for variation in mitochondrial content between samples.

What are the considerations for using MT-ND4 in allotopic expression studies?

Allotopic expression involves nuclear transcription of genes normally transcribed within mitochondria, representing a promising approach for treating mitochondrial disorders. When designing allotopic expression studies with MT-ND4, researchers should consider several critical factors:

First, the coding sequence should be optimized for nuclear expression by adjusting codon usage and eliminating potential cryptic splice sites. Second, a mitochondrial targeting sequence (MTS) must be added to direct the protein to mitochondria after cytoplasmic translation. Studies have shown that associating the MT-ND4 coding sequence with cis-acting elements of human COX10 mRNA significantly improves mitochondrial delivery of the protein . Third, epitope tags (such as HA1) should be appended to the C-terminal to facilitate detection without interfering with mitochondrial import .

In vivo delivery methods must be carefully selected based on the target tissue. For ocular studies involving retinal ganglion cells, recombinant adeno-associated viral vectors (AAV2/2) have demonstrated approximately 75% transduction efficiency when administered via intravitreal injection . Expression should be monitored using RT-qPCR for transcript detection and immunohistochemistry with anti-tag antibodies to visualize mitochondrial localization, which typically appears as punctate fluorescent patterns excluded from nuclei .

How does the structure and function of Sistrurus miliarius MT-ND4 compare to its homologs in other species?

Comparative analysis reveals that MT-ND4 is highly conserved across species, reflecting its essential role in mitochondrial function. When comparing Sistrurus miliarius MT-ND4 with homologs from other species:

The protein belongs to the complex I subunit 4 family, with structural similarities observed across vertebrates . Sequence analysis shows conserved functional domains involved in ubiquinone binding and proton translocation. Most variations occur in non-critical regions, preserving the core functionality of the protein. Mitochondrial genetic studies in the Sistrurus genus, including both S. miliarius and S. catenatus catenatus (Eastern Massasauga Rattlesnake), reveal distinct mitochondrial haplotypes, but conservation of functional domains in proteins like MT-ND4 .

Functional studies have demonstrated that human MT-ND4 can partially rescue mitochondrial dysfunction in heterologous systems, suggesting functional conservation despite sequence variations . This cross-species functional compatibility has important implications for evolutionary biology and potential therapeutic applications in mitochondrial diseases.

How can MT-ND4 be used in the study of mitochondrial disorders?

MT-ND4 serves as an important model for studying mitochondrial disorders, particularly those affecting Complex I. Recombinant Sistrurus miliarius MT-ND4 can be utilized to investigate fundamental aspects of mitochondrial biology and pathology through several approaches:

As a standard for quantitative analysis of MT-ND4 expression levels in disease models, the recombinant protein enables precise calibration of detection methods. In competitive binding assays, it can help identify small molecules that modulate Complex I activity, potentially leading to therapeutic interventions for mitochondrial disorders. For structural studies, purified MT-ND4 contributes to understanding the assembly and organization of Complex I, informing rational drug design targeting specific protein interactions .

What control experiments should be included when working with recombinant MT-ND4?

When designing experiments with recombinant Sistrurus miliarius MT-ND4, comprehensive controls are essential to ensure data validity:

Control TypePurposeImplementation
Expression verificationConfirm protein expressionWestern blot with anti-tag or anti-MT-ND4 antibodies
Subcellular localizationVerify mitochondrial targetingImmunocytochemistry and mitochondrial fractionation
Functional assessmentValidate biological activityComplex I activity assays with and without recombinant protein
Specificity controlEnsure observed effects are MT-ND4-specificParallel experiments with inactive MT-ND4 mutants
Vehicle controlAccount for buffer effectsTreatment with protein storage buffer only
Inter-species comparisonEvaluate evolutionary conservationParallel studies with MT-ND4 from related species

Additionally, when conducting allotopic expression studies, researchers should include controls for vector delivery efficiency, perform RT-qPCR to quantify mRNA expression levels, and normalize data against stable mitochondrial genes such as ATP6 . Time-course experiments are valuable for determining the kinetics of protein expression and integration into functional complexes, with sampling points ranging from 2 to 16 weeks post-intervention .

What techniques can be used to investigate MT-ND4 incorporation into mitochondrial Complex I?

Investigating the incorporation of recombinant MT-ND4 into mitochondrial Complex I requires specialized techniques that assess both physical association and functional integration:

Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE) allows visualization of intact respiratory chain complexes and can be followed by Western blotting to detect MT-ND4 within assembled Complex I. Immunoprecipitation studies using antibodies against established Complex I subunits (such as NDUFA9 or NDUFB8) can pull down associated proteins, including incorporated MT-ND4 . Proximity ligation assays provide in situ evidence of protein-protein interactions between MT-ND4 and other Complex I components.

For functional assessment, researchers can measure NADH:ubiquinone oxidoreductase activity in isolated mitochondria or submitochondrial particles. Complementation studies in cells with MT-ND4 deficiency or mutation can demonstrate whether the recombinant protein restores Complex I function. Protease protection assays help determine the correct membrane topology of incorporated MT-ND4, as properly assembled protein will be protected from proteolytic degradation by the mitochondrial membrane .

What are common challenges in working with recombinant MT-ND4 and how can they be addressed?

Working with recombinant MT-ND4 presents several technical challenges due to its hydrophobic nature and mitochondrial localization:

Low expression yields often occur with transmembrane proteins like MT-ND4. This can be addressed by optimizing codon usage for the expression host, reducing expression temperature to 18-25°C, and using specialized E. coli strains designed for membrane protein expression . Protein misfolding and aggregation can be minimized by including appropriate detergents during purification and maintaining glycerol in storage buffers. For functional studies, incomplete incorporation into Complex I may yield inconsistent results. Researchers should optimize mitochondrial targeting sequences and consider using cell lines with genetic backgrounds compatible with exogenous MT-ND4 integration.

When conducting immunodetection, high background or non-specific signals may occur. This can be improved by increasing blocking stringency and using monoclonal antibodies against protein tags rather than the highly conserved MT-ND4 protein itself . For long-term storage, protein stability issues can be mitigated by adding protease inhibitors to storage buffers and maintaining strict temperature control with minimal freeze-thaw cycles .

How can researchers validate the physiological relevance of findings obtained with recombinant MT-ND4?

Establishing physiological relevance when working with recombinant proteins requires multiple validation approaches:

Comparing the biochemical properties (enzymatic activity, substrate affinity) of recombinant MT-ND4 with those of the native protein extracted from Sistrurus miliarius tissue provides direct validation of functional equivalence. Structure-function analyses using site-directed mutagenesis of conserved residues can confirm that the recombinant protein responds to modifications in a manner consistent with the native protein. In vivo complementation studies, where the recombinant protein rescues phenotypes associated with MT-ND4 deficiency, offer powerful physiological validation .

Cross-species complementation experiments are particularly valuable. Research has shown that human ND4, when expressed in experimental models, can prevent retinal ganglion cell degeneration, preserve Complex I function, and maintain visual function . This indicates functional conservation despite species differences and supports the physiological relevance of findings obtained with recombinant proteins from various species. Researchers should also correlate molecular findings with cellular and organismal phenotypes to establish comprehensive physiological context for their observations.

How might studies of Sistrurus miliarius MT-ND4 contribute to evolutionary understanding of mitochondrial proteins?

Comparative studies of MT-ND4 across different species provide valuable insights into mitochondrial evolution and adaptation:

The Sistrurus genus, including both S. miliarius and S. catenatus catenatus, offers an excellent model for studying mitochondrial genetic variation in closely related species . Research has identified distinct mitochondrial haplotypes within these populations, with most found in only one or two populations of snakes . This genetic diversity in mitochondrial genes like MT-ND4 can be correlated with ecological adaptations and geographical distribution, providing insights into evolutionary pressures on energy metabolism.

Analysis of sequence conservation across diverse species can identify critical functional domains that have been maintained throughout evolution, distinguishing them from more variable regions that may reflect species-specific adaptations. Additionally, the study of nuclear-mitochondrial genetic interactions in different species can reveal co-evolutionary patterns between nuclear and mitochondrially encoded subunits of Complex I. This evolutionary perspective is essential for understanding both fundamental mitochondrial biology and the pathological consequences of mutations in highly conserved proteins like MT-ND4.

What are the prospects for using MT-ND4 allotopic expression in therapeutic applications?

Allotopic expression of MT-ND4 shows significant potential for treating mitochondrial disorders, particularly those affecting Complex I function:

Research has demonstrated that optimized allotopic expression of ND4 can rescue respiratory chain dysfunction in cells harboring mutations in mitochondrial genes . In experimental models of Leber hereditary optic neuropathy, a disease caused by mutations in MT-ND4, allotopic expression of the functional gene significantly prevents retinal ganglion cell degeneration and preserves both Complex I function and visual performance . These findings provide proof-of-concept for gene therapy approaches targeting mitochondrial disorders.

For effective therapeutic application, several technical aspects require further development. Delivery systems must be optimized for specific target tissues, with adeno-associated viral vectors showing promise for ocular delivery with approximately 75% transduction efficiency in retinal ganglion cells . Expression kinetics need careful characterization, with studies showing detectable human ND4 mRNA two weeks after vector administration and stable expression for at least 14 weeks . Mitochondrial targeting efficiency can be enhanced by incorporating cis-acting elements from nuclear-encoded mitochondrial proteins, such as COX10, which improve localization of the mRNA to the mitochondrial surface where translation and transport can be coupled .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.