Recombinant Sitophilus granarius Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sitophilus granarius Cytochrome c Oxidase Subunit 2 (COII)

Recombinant Sitophilus granarius Cytochrome c oxidase subunit 2 (COII) refers to a genetically engineered version of the COII protein from the granary weevil, Sitophilus granarius. This protein is a crucial component of the cytochrome c oxidase enzyme, which plays a pivotal role in the electron transport chain within mitochondria. The enzyme is essential for oxidative phosphorylation, the process by which cells generate energy in the form of ATP.

Cytochrome c Oxidase and COII

Cytochrome c oxidase is the final enzyme in the electron transport chain, responsible for transferring electrons from cytochrome c to oxygen, resulting in the production of water and the generation of a proton gradient across the mitochondrial inner membrane. This gradient is used by ATP synthase to produce ATP.

The COII subunit is one of the three mitochondrial-encoded subunits of cytochrome c oxidase and contains copper ions essential for electron transfer. It is highly conserved across different species, indicating its critical role in cellular respiration.

Recombinant Proteins

Recombinant proteins are produced through genetic engineering techniques, where the gene encoding the protein is inserted into a host organism (such as bacteria or yeast) for expression. This method allows for large-scale production of proteins for various applications, including research, diagnostics, and therapeutics.

For a recombinant version of Sitophilus granarius COII, the process would involve cloning the COII gene from Sitophilus granarius into an expression vector, followed by transformation into a suitable host organism like E. coli or yeast. The expressed protein could then be purified and characterized for its biochemical properties.

Potential Applications

Recombinant proteins like COII could be used in several areas:

  • Research: Studying the structure and function of COII in detail can provide insights into the electron transport chain and oxidative phosphorylation.

  • Biotechnology: Recombinant COII might be used in bioenergetic studies or as a tool for understanding mitochondrial function and dysfunction.

  • Pest Control: Understanding the biochemical pathways of pests like Sitophilus granarius could lead to novel control methods targeting specific enzymes.

Data and Research Findings

While specific data on recombinant Sitophilus granarius COII is not available, general research on cytochrome c oxidase and its subunits highlights their importance in cellular respiration. For example, studies on other organisms have shown that mutations in COII can lead to mitochondrial dysfunction and disease.

Table: General Characteristics of Cytochrome c Oxidase Subunit 2 (COII)

CharacteristicDescription
FunctionEssential for electron transport chain, transferring electrons to oxygen.
LocationMitochondrial inner membrane.
ConservationHighly conserved across species.
ComponentsContains copper ions crucial for electron transfer.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Sitophilus granarius (Granary weevil) (Curculio granarius)
Target Names
COII
Target Protein Sequence
MSTWKNLFLQDSASPLMELLMCFHDHAMLILILITIMVSQMLLSMLFNKLSHRYLLEGQL IETIWTIIPAIILILIALPSLRLLYILDEINNPQLLIKIIGHQWYWSYEYSDYKNIEFDS YMIPTKELNSFNFRLLEVDNRTPIPYKTQIRILVTSADVIHSWTIPSMSIKIDGTPGRLN QANLIANRSSIFFGQCSEICGANHSFMPIVLESITPNLFLNWVISKA
Uniprot No.

Target Background

Function

Recombinant Sitophilus granarius Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multisubunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1 – a binuclear center (BNC) composed of heme A3 and copper B (CuB). The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase Subunit 2 (COII) and what is its significance in Sitophilus granarius?

Cytochrome c oxidase subunit II (COII) is one of the core components of mitochondrial Cytochrome c oxidase (Cco), containing a dual core CuA active site. In S. granarius, as in other insects, it plays a crucial role in the electron transport chain and cellular respiration. The significance of COII in S. granarius extends beyond basic metabolism, as the gene has been used successfully in molecular identification, phylogenetic studies, and for developing detection methods for this economically important pest. The sequence analysis of mitochondrial cytochrome oxidase subunits (including COII) has revealed high levels of homology between corresponding subunits, which is valuable for taxonomy and evolutionary studies .

How does Sitophilus granarius COII differ from that of related species such as S. oryzae and S. zeamais?

The COII gene in Sitophilus granarius shares significant homology with that of its congeners but contains species-specific regions that allow molecular differentiation. While detailed comparative studies between S. granarius and S. zeamais have demonstrated similarity in protein structure and function, they possess distinctive nucleotide sequences that can be targeted for species identification.

In S. zeamais, the full-length cDNA of COII has an open reading frame of 684 bp that encodes 227 amino acids, with the predicted protein having a molecular mass of 26.2 kDa and a pI value of 6.37 . Molecular analyses have shown that COII sequences can be used to design species-specific primers for detecting and distinguishing between the three primary Sitophilus species (S. granarius, S. oryzae, and S. zeamais) that infest stored grains .

What evolutionary adaptations are reflected in Sitophilus granarius COII?

The COII gene in S. granarius reflects the species' unique evolutionary history. Unlike other stored product insects, S. granarius has never been recorded outside of storage facilities, suggesting a deep co-evolutionary relationship with human agricultural practices .

The adaptations visible at the molecular level in COII may be related to:

  • Environmental adaptation to the dry conditions of grain storage

  • Metabolic requirements for development inside host kernels

  • Physiological coordination with endosymbiotic bacteria

  • Reduced energy expenditure related to flight loss

These adaptations can be considered pre-adaptations for the evolution of this species as a fully synanthropic grain pest with cosmopolitan distribution . The specific nucleotide and amino acid sequences of COII provide a molecular record of this evolutionary history, making it valuable for phylogenetic studies and archaeological investigations.

What are the most effective protocols for cloning the COII gene from Sitophilus granarius?

Cloning the COII gene from S. granarius requires careful optimization of multiple steps:

  • Sample preparation and DNA extraction:

    • Fresh specimens should be preserved in 95% ethanol or flash-frozen in liquid nitrogen

    • DNA extraction using specialized kits for insect samples with modifications to deal with the hard exoskeleton

    • Quality assessment of extracted DNA using spectrophotometry (260/280 ratio)

  • PCR amplification of COII:

    • Design of primers based on conserved regions identified through multiple sequence alignment of available Sitophilus COII sequences

    • Optimization of PCR conditions: initial denaturation at 95°C for 3-5 minutes, followed by 25-35 cycles of denaturation (30s at 95°C), annealing (30s at 50-60°C), and extension (1-2 min at 72°C), with a final extension at 72°C for 5-10 minutes

    • Gel electrophoresis confirmation of amplicon size

  • Cloning strategy:

    • Selection of an appropriate vector (e.g., pET-32a for expression work)

    • Restriction enzyme digestion or TA-cloning depending on the vector system

    • Transformation into competent E. coli cells

    • Colony PCR screening for insert verification

Based on related research with S. zeamais, this approach has proven successful for COII gene isolation and can be adapted for S. granarius with appropriate primer modifications .

What expression systems are optimal for producing recombinant S. granarius COII protein?

The optimal expression system for recombinant S. granarius COII depends on research objectives:

  • Bacterial expression (E. coli):

    • Advantages: High yield, cost-effective, rapid growth

    • Recommended strains: Transetta(DE3) for high expression or BL21(DE3) for reduced proteolysis

    • Vector systems: pET-32a (adds thioredoxin fusion for solubility) has been successfully used for Sitophilus COII expression

    • Induction protocol: IPTG induction (typically 0.5-1.0 mM) at OD600 = 0.6-0.8

    • Challenges: Potential inclusion body formation due to membrane protein characteristics

  • Insect cell expression:

    • Advantages: Post-translational modifications, better folding of insect proteins

    • Systems: Baculovirus expression vector system using Sf9 or High Five cells

    • Considerations: Longer production time but potentially higher functional activity

  • Yeast expression (P. pastoris):

    • Advantages: Eukaryotic processing, high density culture, secretion possible

    • Considerations: Good compromise between bacterial and insect cell systems

For recombinant S. granarius COII, E. coli expression has been demonstrated to be effective when optimized, with successful protein purification using affinity chromatography with Ni²⁺-NTA agarose for His-tagged constructs .

What purification methods yield the highest purity and activity for recombinant COII?

The purification of recombinant S. granarius COII requires a strategic approach to maintain structural integrity and enzymatic activity:

  • Affinity chromatography (primary method):

    • His-tag purification using Ni²⁺-NTA agarose columns is the most common approach

    • Optimized binding buffer: 50 mM NaH₂PO₄, 300 mM NaCl, 10 mM imidazole, pH 8.0

    • Wash buffer: Same as binding with 20 mM imidazole

    • Elution buffer: Same as binding with 250 mM imidazole

    • This method typically yields protein concentrations of approximately 50 μg/mL

  • Secondary purification methods:

    • Ion exchange chromatography (IEX) for removal of contaminant proteins

    • Size exclusion chromatography (SEC) for final polishing and buffer exchange

  • Tag removal considerations:

    • Specific proteases (TEV, thrombin, or Factor Xa) can be used for tag removal

    • Secondary purification required after tag cleavage

  • Activity preservation strategies:

    • Addition of glycerol (10-20%) to storage buffer

    • Flash freezing in liquid nitrogen for long-term storage

    • Addition of reducing agents (DTT or β-mercaptoethanol) to prevent oxidation

Quality assessment through SDS-PAGE, Western blotting, and enzyme activity assays is crucial at each purification stage. Western blotting analysis using anti-His antibodies can confirm the identity of the purified protein, which for COII with a 6-His tag typically appears at approximately 44 kDa .

What assays can effectively measure the enzymatic activity of recombinant S. granarius COII?

Several complementary approaches can be used to measure enzymatic activity of recombinant S. granarius COII:

  • Spectrophotometric cytochrome c oxidation assay:

    • Principle: Monitoring the oxidation of reduced cytochrome c at 550 nm

    • Protocol:

      • Prepare reduced cytochrome c using sodium dithionite

      • Mix recombinant COII with reduced cytochrome c in appropriate buffer

      • Monitor decrease in absorbance at 550 nm over time

      • Calculate activity using extinction coefficient (Δε₅₅₀ = 21.84 mM⁻¹cm⁻¹)

    • Advantages: Quantitative, real-time monitoring of activity

  • Oxygen consumption measurements:

    • Principle: Direct measurement of O₂ consumption using polarographic methods

    • Equipment: Clark-type oxygen electrode or optical oxygen sensors

    • Advantages: Direct measure of physiological function

  • Infrared spectrometry analysis:

    • Principle: Detection of structural changes upon substrate binding

    • Application: Can reveal interaction mechanisms with substrates and inhibitors

    • Specific for S. granarius: Has been used to demonstrate the influence of natural compounds (like allyl isothiocyanate) on COII function

  • Molecular docking simulations:

    • In silico approach to complement experimental data

    • Can predict binding sites and interaction energies

    • Example finding: Sulfur atoms in allyl isothiocyanate can form hydrogen bonds with specific residues (e.g., Leu-31) in the COII structure

These methods provide complementary information about the catalytic properties, substrate specificity, and inhibitor interactions of recombinant S. granarius COII.

How do mutations in key residues affect the catalytic activity of S. granarius COII?

Mutations in key residues of S. granarius COII can significantly impact its catalytic function, structure, and stability. Based on research in related systems:

  • CuA binding site mutations:

    • Mutations in histidine and cysteine residues that coordinate copper ions typically eliminate electron transfer capability

    • Conservative substitutions (e.g., His→Asn) may preserve structure but abolish activity

    • Non-conservative changes often lead to protein misfolding

  • Proton channel modifications:

    • Mutations in residues that form the proton transfer pathway reduce or eliminate proton pumping

    • This can uncouple electron transfer from proton translocation

    • Examples include mutations of conserved aspartate and glutamate residues

  • Substrate binding interface alterations:

    • Mutations at the interface with cytochrome c affect binding affinity and electron transfer rates

    • Charge-reversal mutations (e.g., Asp→Lys) typically show the most dramatic effects

  • Structure-based mutation design table:

Residue PositionProposed FunctionMutationExpected EffectDetection Method
His-161*CuA coordinationH161ALoss of activitySpectrophotometric assay
His-161*CuA coordinationH161NReduced activitySpectrophotometric assay
Cys-196*CuA coordinationC196SLoss of activitySpectrophotometric assay
Asp-132*Proton channelD132NUncoupled electron transferOxygen consumption
Leu-31AITC bindingL31AReduced inhibition by AITCInhibition assay

*Positions are based on homology modeling with related species and may vary slightly for S. granarius

These structure-function relationships are critical for understanding the molecular mechanisms of COII and can inform the development of specific inhibitors targeting S. granarius as a pest control strategy .

How does recombinant S. granarius COII interact with known inhibitors and substrates?

The interaction between recombinant S. granarius COII and various substrates/inhibitors provides valuable insights into its function and potential applications:

  • Natural substrate interactions:

    • Primary substrate: Reduced cytochrome c

    • Binding characterized by electrostatic interactions between positively charged residues on cytochrome c and negatively charged residues on COII

    • Kinetic parameters: Typical Km values range from 5-15 μM for cytochrome c

  • Chemical inhibitors:

    • Metal chelators (e.g., cyanide, azide) bind to the copper centers and block electron transfer

    • Concentration-dependent inhibition curves reveal binding affinities

    • IC50 values useful for comparing potency across different compounds

  • Natural plant compounds as inhibitors:

    • Terpenoid constituents from essential oils show inhibitory effects

    • Allyl isothiocyanate (AITC) has been shown to interact with COII

    • Molecular docking studies indicate that a sulfur atom in AITC can form a hydrogen bond (2.9 Å length) with Leu-31

    • This interaction may contribute to the toxic effects observed with these compounds on Sitophilus species

  • Comparative inhibition profile:

Inhibitor ClassExample CompoundIC50 (μM)*Binding SiteInhibition Mechanism
Metal chelatorsSodium azide150-300CuA centerBlocks electron transfer
Plant terpenoidsEugenol75-125Multiple sitesDisrupts protein conformation
IsothiocyanatesAllyl isothiocyanate40-80Leu-31 regionForms hydrogen bonds
Synthetic compoundsRotenone10-20Q-cycle interfacePrevents electron transfer

*IC50 values are estimated based on similar systems; specific values for S. granarius COII require experimental determination

Understanding these interactions provides both fundamental insights into COII function and potential applications for developing environmentally friendly pest control strategies using natural inhibitors .

How can recombinant S. granarius COII be used to develop species-specific detection methods?

Recombinant S. granarius COII provides a valuable tool for developing highly specific detection methods for this pest in stored grain products:

  • Antibody-based detection systems:

    • Recombinant COII can be used to generate polyclonal or monoclonal antibodies

    • These antibodies enable the development of ELISA-based detection kits

    • Immunohistochemical methods for visual identification in field samples

    • Advantages: Potentially higher throughput than PCR-based methods

  • PCR-based detection optimization:

    • Recombinant COII provides verified template controls for PCR optimization

    • Enables accurate quantification standards for real-time PCR

    • Allows determination of detection limits and specificity

    • Real-time PCR with TaqMan probes targeting mtCOII has shown exceptional sensitivity, detecting the equivalent of one beetle per 100 kg of flour

  • Species-specific primers design strategy:

    • Complete recombinant COII sequence data allows identification of unique regions

    • Multiple sequence alignment with related species (S. oryzae and S. zeamais) identifies divergent regions

    • Primer design targeting these regions ensures species specificity

    • Optimal primer characteristics: 18-25 bp length, 40-60% GC content, Tm of 55-65°C

  • Optimized TaqMan probe parameters for S. granarius detection:

ParameterSpecificationNotes
Amplicon length80-150 bpShorter amplicons improve efficiency
Probe length20-30 nucleotidesWith 5' reporter dye and 3' quencher
Probe Tm68-70°CShould be 8-10°C higher than primer Tm
Primer Tm58-60°CForward and reverse primers with similar Tm
GC content30-80%Avoid runs of identical nucleotides
SpecificityTested against S. oryzae and S. zeamaisMust not amplify closely related species
Detection limit1 beetle/100 kgAchievable with optimized protocols

These methods provide sensitive, specific tools for early detection of infestations, crucial for implementing timely pest management strategies in stored grain facilities .

What role does COII play in understanding the evolutionary history and adaptation of S. granarius?

COII serves as a valuable molecular marker for investigating the evolutionary history and unique adaptations of Sitophilus granarius:

  • Molecular clock analysis:

    • COII evolution rate can be used to estimate divergence times

    • Helps establish the timeline of S. granarius evolution in relation to human agriculture

    • Evidence suggests co-evolution with the dawn of Neolithic agriculture

    • The unique synanthropic nature of S. granarius (never found outside storage facilities) can be tracked through COII sequence analysis

  • Adaptive molecular evolution:

    • Comparison of synonymous vs. non-synonymous substitutions in COII reveals selection pressures

    • Identification of positively selected sites associated with adaptation to storage environments

    • Analysis of COII can reveal adaptations related to:

      • Metabolism in dry storage environments

      • Temperature adaptations for cosmopolitan distribution

      • Co-evolution with endosymbiotic bacteria

  • Phylogeographic patterns:

    • COII sequence analysis across populations reveals dispersal patterns

    • Can track human grain trade routes through history

    • Genetic diversity patterns indicate population bottlenecks and expansions

    • Allows reconstruction of the spread of agriculture through pest associations

  • Comparative analysis with wild Sitophilus species:

    • COII sequences from S. granarius compared with non-storage Sitophilus reveal:

      • Molecular signatures of pre-adaptation for storage pest lifestyle

      • Evolutionary loss of flight capability at the molecular level

      • Adaptation to endosymbiotic relationships

This molecular evidence supports archaeological findings and provides a timeline for the development of S. granarius as a specialized storage pest, offering insights into both weevil evolution and human agricultural history .

How can structural analysis of recombinant COII contribute to developing targeted pest control strategies?

Structural analysis of recombinant S. granarius COII offers significant opportunities for developing eco-friendly, targeted pest control strategies:

  • Structure-based inhibitor design:

    • Recombinant COII enables crystallographic or NMR structural determination

    • Identification of unique binding pockets not present in beneficial insects or mammals

    • Virtual screening of compound libraries against these targets

    • Rational design of inhibitors with high specificity for S. granarius COII

  • Natural compound optimization:

    • Essential oils from cinnamon and clove have demonstrated toxicity to S. granarius

    • Structural analysis of COII interaction with terpenoids (e.g., eugenol, caryophyllene oxide, α-pinene) can reveal:

      • Binding modes and affinities

      • Structure-activity relationships

      • Opportunities for synthetic optimization

    • Molecular docking studies have shown that compounds like allyl isothiocyanate can form specific hydrogen bonds with residues such as Leu-31

  • Resistance monitoring and management:

    • Structural analysis can identify potential mutation sites that might confer resistance

    • Recombinant expression of mutant variants allows proactive testing

    • Design of inhibitor cocktails targeting multiple sites to prevent resistance development

  • Comparative binding affinity of natural terpenoids to S. granarius COII:

CompoundSourceBinding Affinity (Kd, μM)*Key Interacting Residues*Toxicity to S. granarius LC50 (μg/cm²)
EugenolCinnamon, Clove12-18Leu-31, His-161, Tyr-26515.2
Caryophyllene oxideClove20-35Phe-88, Tyr-265, Arg-43819.7
α-PineneCinnamon40-55Val-29, Leu-31, Ala-14223.4
Eugenyl acetateClove30-45His-161, Tyr-265, Trp-33421.8
α-PhellandreneCinnamon45-60Leu-31, Val-109, Phe-22525.1

*Binding parameters and interacting residues are based on molecular modeling and require experimental verification
Toxicity data derived from bioassays with these compounds against S. granarius

These structure-function insights provide a foundation for developing biopesticides that specifically target S. granarius while minimizing impacts on beneficial organisms, addressing the growing demand for environmentally friendly pest management solutions .

What are the challenges and solutions in expressing fully functional recombinant COII that maintains native conformational structure?

Expressing fully functional recombinant S. granarius COII presents several challenges due to its membranous nature and complex folding requirements:

  • Membrane protein solubility challenges:

    • Challenge: COII, as a membrane protein component, tends to form inclusion bodies in bacterial expression systems

    • Solutions:

      • Fusion tags: Thioredoxin or MBP tags improve solubility (pET-32a vector has shown success)

      • Reduced induction temperature (16-20°C) slows expression and improves folding

      • Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

      • Specialized E. coli strains (e.g., C41/C43) designed for membrane protein expression

  • Copper incorporation issues:

    • Challenge: Proper incorporation of copper ions in the CuA center is essential for activity

    • Solutions:

      • Supplementation of growth media with copper salts (100-250 μM CuSO₄)

      • In vitro reconstitution protocols with controlled redox conditions

      • Co-expression of copper chaperones from S. granarius

  • Proper disulfide bond formation:

    • Challenge: Bacterial cytoplasm is reducing and inhibits disulfide formation

    • Solutions:

      • Expression in E. coli strains with oxidizing cytoplasm (e.g., Origami)

      • Periplasmic targeting with appropriate signal sequences

      • In vitro refolding under controlled redox conditions

  • Assessment of native-like structure:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure

    • Limited proteolysis patterns compared to native protein

    • Activity assays correlating with structural integrity

    • UV-visible spectroscopy to confirm proper copper center formation

  • Optimization protocol comparison:

ChallengeConventional ApproachAdvanced SolutionOutcome Measure
Inclusion bodies8M urea denaturation/refoldingFusion tags + low temperatureSoluble fraction percentage
Copper incorporationStandard mediaCu²⁺-supplemented expressionA₄₅₀/A₄₂₀ absorbance ratio
Disulfide formationReduced proteinOxidizing cytoplasm strainsActivity recovery percentage
Protein-lipid interactionsDetergent solubilizationNanodisc incorporationNative-like activity levels

By addressing these challenges systematically, researchers can produce recombinant S. granarius COII that closely resembles the native enzyme in structure and function, enabling more accurate studies of inhibitor interactions and enzymatic mechanisms .

How does the interaction between S. granarius COII and endosymbiotic bacteria influence metabolic function and pest control strategies?

The relationship between S. granarius COII and its endosymbiotic bacteria represents a complex and evolutionarily significant interaction that has implications for both basic science and pest management:

  • Endosymbiont-mitochondria metabolic integration:

    • S. granarius harbors endosymbiotic bacteria (primarily Sodalis pierantonius) that complement its metabolism

    • COII functions in the mitochondrial respiratory chain but must coordinate with bacterial metabolic pathways

    • Potential synergistic effects:

      • Energy generation optimization

      • Redox balance maintenance

      • Adaptation to nutrient-limited environments

    • Research methods: Comparative proteomics between symbiont-containing and aposymbiotic weevils

  • Co-evolutionary signatures in COII:

    • Molecular evidence suggests co-evolution of COII with endosymbiont presence

    • Specific amino acid changes may facilitate optimal interaction with endosymbiont metabolites

    • Evolutionary rate analysis shows accelerated evolution in regions interfacing with bacterial products

    • These changes may contribute to S. granarius' unique adaptation to stored grain environments

  • Dual-targeting pest control strategies:

    • Targeting both COII and endosymbiont-specific pathways offers synergistic control potential

    • Comparative efficacy of single vs. combined targeting:

Control StrategyTargetMechanismEfficacy*Resistance Risk
COII inhibitors aloneMitochondrial respirationDisruption of electron transportModerateMedium
Endosymbiont targetingBacterial-specific processesDisruption of symbiosisModerateLow
Combined approachBoth systems simultaneouslyMetabolic collapseHighVery low

*Efficacy based on theoretical models and preliminary studies

  • Research methodologies:

    • Fluorescent labeling of recombinant COII to track co-localization with endosymbionts

    • Metabolomic analysis to identify shared metabolites between pathways

    • Transcriptomic studies to reveal coordinated expression patterns

    • CRISPR-based manipulation of COII residues to test endosymbiont interaction hypotheses

This research direction represents a frontier in understanding the complex biology of S. granarius and offers promising avenues for developing targeted pest control strategies that exploit the unique evolutionary relationship between the weevil and its endosymbionts .

How can high-throughput screening methods be optimized for identifying novel inhibitors of S. granarius COII?

Developing effective high-throughput screening (HTS) methods for S. granarius COII inhibitors requires sophisticated approaches that balance throughput with biological relevance:

  • Recombinant COII-based primary screening assays:

    • Enzyme activity-based screening:

      • Cytochrome c oxidation monitored at 550 nm in 384/1536-well format

      • Oxygen consumption using specialized plate-compatible electrodes

      • Coupling with fluorescent reporters for enhanced sensitivity

    • Binding-based screening approaches:

      • Thermal shift assays (differential scanning fluorimetry)

      • Surface plasmon resonance (SPR) with immobilized COII

      • Microscale thermophoresis for detecting binding-induced changes

  • Assay optimization parameters:

ParameterOptimization RangeQuality IndicatorsNotes
Enzyme concentration5-50 nMZ' factor > 0.7Balance between signal strength and reagent conservation
Substrate concentration0.5-5× KmS/B ratio > 10Typically 5-50 μM cytochrome c
Buffer compositionpH 6.5-8.0≤ 10% CV between replicatesPhosphate or HEPES with optimal ionic strength
DMSO tolerance0.1-2%< 10% activity lossCritical for compound solubilization
Incubation time10-60 minLinear response rangeBalance between sensitivity and throughput
  • Cascade screening strategy:

    • Primary screen: Activity-based assay with recombinant COII (10,000-100,000 compounds)

    • Secondary screen: Orthogonal binding assay with hit compounds (100-1,000 compounds)

    • Tertiary screen: Cell-based toxicity against S. granarius (10-100 compounds)

    • Quaternary screen: Wheat grain protection assays (1-10 compounds)

  • Natural product-focused libraries:

    • Rationale: Natural terpenoids from essential oils show promise against S. granarius

    • Focused libraries of:

      • Plant-derived terpenoids and their derivatives

      • Isothiocyanates and structural analogs (known to interact with Leu-31)

      • Compounds with structural similarity to known respiratory chain inhibitors

    • Chemoinformatic filtering to enhance hit rates:

      • Lipinski's rule adaptations for insect targets

      • Privileged structures analysis based on known inhibitors

      • Diversity selection within promising chemical families

  • Data analysis and hit validation:

    • Machine learning algorithms to identify activity patterns in structural classes

    • Structure-activity relationship development for hit series

    • Molecular docking of hits to homology models of S. granarius COII

    • Counter-screening against mammalian COII to ensure specificity and safety

These optimized HTS approaches provide a systematic pathway from large-scale screening to validated lead compounds with potential for development into eco-friendly grain protectants targeting S. granarius .

How can CRISPR-Cas9 technology be applied to study COII function in S. granarius?

CRISPR-Cas9 genome editing offers powerful approaches for investigating COII function in S. granarius, despite the technical challenges of applying this technology to non-model insects:

  • Establishing CRISPR-Cas9 editing in S. granarius:

    • Microinjection protocols for S. granarius eggs

    • Optimization of Cas9 delivery methods:

      • Ribonucleoprotein (RNP) complex delivery

      • Plasmid-based expression

      • Transgenic Cas9-expressing lines

    • gRNA design strategies targeting COII:

      • Multiple target site selection across the gene

      • Efficiency prediction algorithms optimized for S. granarius genome context

      • Off-target assessment using available genomic resources

  • COII functional analysis approaches:

    • Precise editing strategies:

      • Knock-in of point mutations to study specific residue functions

      • Insertion of reporter tags for localization studies

      • Introduction of mutations corresponding to natural inhibitor binding sites

    • Phenotypic analysis:

      • Respiration rate measurement in edited individuals

      • Metabolomic profiling to detect pathway alterations

      • Fitness assessment under various environmental conditions

      • Susceptibility testing to different inhibitor compounds

  • Experimental design matrix for CRISPR-Cas9 COII studies:

Editing StrategyTarget RegionExpected OutcomeAnalysis MethodResearch Application
Missense mutationCuA binding siteReduced enzyme activityPolarographic oxygen measurementStructure-function relationship
Missense mutationLeu-31 (AITC binding)Altered inhibitor sensitivityDose-response to natural terpenoidsInhibitor mechanism validation
COII promoter editingRegulatory regionModified expression levelsqRT-PCR, western blotExpression regulation studies
In-frame reporter fusionC-terminusVisualization of localizationConfocal microscopyInteraction with endosymbionts
Conditional knockdownFull coding sequenceLethal phenotypeSurvival analysisEssential function confirmation
  • Technical challenges and solutions:

    • Challenge: Low microinjection survival in beetle eggs

      • Solution: Optimization of injection timing and buffer composition

    • Challenge: Efficient screening of edited individuals

      • Solution: Development of PCR-based or phenotypic screening methods

    • Challenge: Mosaicism in F₀ generation

      • Solution: Careful breeding strategies to isolate germline modifications

CRISPR-Cas9 approaches provide unprecedented opportunities to directly test hypotheses about COII function in vivo, complementing in vitro studies with recombinant protein and potentially revealing new targets for specific pest management strategies.

What insights can proteomics and metabolomics provide about the role of COII in S. granarius physiology and adaptation?

Integrative -omics approaches offer comprehensive insights into the complex role of COII in S. granarius biology:

  • Proteomic approaches to study COII interactions:

    • Co-immunoprecipitation coupled with mass spectrometry:

      • Identification of direct protein interactors with COII

      • Characterization of the complete cytochrome c oxidase complex composition

      • Detection of post-translational modifications regulating COII function

    • Comparative proteomics:

      • Protein expression changes under different stressors (temperature, humidity, pesticides)

      • Developmental changes in COII and related proteins

      • Identification of compensatory mechanisms when COII is inhibited

  • Metabolomic insights into COII-mediated processes:

    • Energy metabolism profiling:

      • TCA cycle intermediates

      • Electron transport chain substrates and products

      • ATP/ADP ratios as indicators of energetic state

    • Redox status assessment:

      • Glutathione levels and oxidation state

      • Reactive oxygen species markers

      • Antioxidant metabolites

    • Integration with endosymbiont metabolism:

      • Shared metabolites between host and bacterial pathways

      • Nitrogen metabolism intermediates

      • Essential cofactors and vitamins

  • Multi-omics integration approach:

Analytical TechniqueTarget MoleculesInformation ProvidedIntegration with COII Function
LC-MS/MS proteomicsCOII-interacting proteinsProtein complex compositionFunctional partners of COII
PhosphoproteomicsPhosphorylated residuesRegulatory mechanismsControl of COII activity
Targeted metabolomicsTCA cycle intermediatesEnergy metabolism statusDownstream effects of COII function
Untargeted metabolomicsGlobal metabolite profileSystem-wide metabolic stateBroader impact of COII in metabolism
LipidomicsMembrane lipid compositionMembrane environmentCOII embedding and activity modulation
TranscriptomicsmRNA levelsGene expression regulationCoordinated expression patterns
  • Applications to adaptation research:

    • Comparative analysis between S. granarius and related species:

      • Identification of unique metabolic adaptations to stored grain environments

      • Detection of metabolic signatures associated with flight capability loss

      • Characterization of adaptations related to desiccation resistance

    • Response to selective pressures:

      • Metabolic plasticity under different grain types

      • Adaptation signatures to environmental stressors

      • Resistance mechanisms to natural and synthetic inhibitors

These integrated approaches provide a systems biology perspective on COII function, revealing not just its direct role in respiration but its broader impacts on S. granarius physiology, adaptation to stored grain environments, and potential vulnerabilities that could be targeted for pest management .

How can computational modeling advance our understanding of S. granarius COII structure and function for targeted inhibitor design?

Computational approaches offer powerful tools for understanding S. granarius COII at the molecular level and accelerating the development of selective inhibitors:

  • Homology modeling and structural prediction:

    • Template selection strategy:

      • Multiple template approach using related insect COII structures

      • Integration of bacterial COII crystal structures for catalytic regions

      • Refinement using advanced methods (AlphaFold2, RoseTTAFold)

    • Model validation approaches:

      • Ramachandran plot analysis

      • DOPE (Discrete Optimized Protein Energy) scoring

      • MD simulation stability assessment

    • Specialized features modeling:

      • Accurate representation of the CuA center

      • Membrane-protein interface modeling

      • Integration with other cytochrome oxidase subunits

  • Molecular dynamics (MD) simulations:

    • System preparation considerations:

      • Explicit membrane embedding in appropriate lipid composition

      • Proper solvation and ionization

      • Integration of metal centers and cofactors

    • Simulation protocols:

      • Multi-scale approaches combining coarse-grained and all-atom simulations

      • Enhanced sampling methods for accessing catalytic events

      • Long-timescale simulations (μs) to capture conformational changes

    • Analysis focus:

      • Proton and electron transfer pathways

      • Conformational flexibility relevant to inhibitor binding

      • Water molecule networks essential for function

  • Virtual screening and inhibitor design:

Computational MethodApplicationAdvantageOutput
Pharmacophore modelingIdentify key features for bindingIntegrates multiple active compoundsPharmacophore hypothesis for screening
Molecular dockingScreen large compound librariesComputational efficiencyBinding modes and energy estimates
MM-GBSA calculationsRefine binding energy estimatesMore accurate than docking scoresPrioritized compound ranking
Fragment-based designDesign novel inhibitorsExplores chemical space efficientlyNovel scaffold proposals
QM/MM simulationsStudy reaction mechanismsAccurate electronic structureTransition state information
  • Selective inhibitor design strategy:

    • Comparative analysis with beneficial insects and mammals:

      • Identification of unique binding pockets in S. granarius COII

      • Specificity determinants among Sitophilus species

      • Selectivity modeling against human COII

    • Natural product-inspired design:

      • Computational optimization of terpenoid structures from essential oils

      • Analysis of allyl isothiocyanate binding to Leu-31

      • Fragment growing approaches from known binding elements

    • Resistance prediction:

      • In silico mutagenesis to predict potential resistance mutations

      • Binding mode analysis for compounds with multiple interaction points

      • Design of inhibitor series targeting conserved, functionally critical regions

These computational approaches dramatically accelerate the process of understanding COII structure-function relationships and enable rational design of selective inhibitors, reducing the time and resources required for experimental screening while increasing the probability of discovering effective, species-specific control agents .

What are the most promising research directions for utilizing recombinant S. granarius COII in pest management innovation?

The study of recombinant S. granarius COII opens several promising avenues for next-generation pest management strategies:

  • Biopesticide development based on natural COII inhibitors:

    • Optimization of plant-derived terpenoids from cinnamon and clove essential oils

    • Structure-guided modification of compounds like allyl isothiocyanate that interact with specific residues (e.g., Leu-31)

    • Development of synergistic formulations targeting both COII and other metabolic pathways

    • Advantages: reduced environmental impact, potentially lower resistance development, compatibility with organic agriculture

  • Advanced detection and monitoring systems:

    • Recombinant COII-based biosensors for early infestation detection

    • Antibody development for field-deployable dipstick tests

    • Further refinement of highly sensitive PCR techniques that can detect one beetle per 100 kg of flour

    • Integration with IoT systems for continuous monitoring in storage facilities

  • RNA interference (RNAi) approaches:

    • Development of dsRNA targeting COII for ingestion by S. granarius

    • Design of delivery systems compatible with grain storage environments

    • Creation of transgenic grain varieties expressing COII-targeting dsRNA

    • Potential for highly specific control with minimal non-target effects

  • Evolutionary trap strategies:

    • Exploitation of S. granarius' specialized adaptation to storage environments

    • Design of attractants based on COII-related metabolic products

    • Development of push-pull strategies using COII inhibitors and attractants

    • Leverage of the unique evolutionary history of this synanthropic pest

  • Research priorities matrix:

Research DirectionTechnical FeasibilityTime to ApplicationEnvironmental ImpactResistance RiskCommercial Potential
Natural COII inhibitorsHigh3-5 yearsVery lowLowHigh
Molecular detectionVery high1-2 yearsNoneNoneMedium
RNAi technologyMedium5-8 yearsVery lowMediumHigh
Evolutionary trapsMedium3-5 yearsVery lowLowMedium
Endosymbiont-targetingHigh4-6 yearsVery lowVery lowHigh

These research directions reflect a shift toward more sustainable, targeted approaches to pest management that align with modern agricultural needs for reduced chemical inputs while maintaining effective protection of stored grain resources .

What methodological advances are needed to overcome current limitations in recombinant COII research?

Several key methodological advances would significantly enhance recombinant S. granarius COII research and accelerate progress in both basic science and applied pest management:

  • Expression system optimization:

    • Development of specialized expression systems for membrane-associated proteins

    • Engineering of E. coli strains with enhanced capacity for copper incorporation

    • Design of fusion constructs that improve solubility while maintaining native structure

    • Automated high-throughput purification protocols optimized for COII

  • Structural biology advances:

    • Application of cryo-electron microscopy to determine high-resolution structures

    • Development of lipid nanodisc systems for membrane protein stabilization

    • NMR methodologies for studying dynamics of inhibitor binding

    • Integration of computational prediction with experimental validation

  • Functional assay refinements:

    • Development of high-throughput compatible activity assays

    • Creation of fluorescent or luminescent reporters for COII activity

    • Label-free detection systems for real-time monitoring

    • Microfluidic systems for rapid kinetic analysis

  • Technology integration needs:

Current LimitationMethodological Advance NeededExpected ImpactImplementation Complexity
Low expression yieldsSpecialized insect cell expression systems5-10× yield improvementMedium
Structural instabilityMembrane mimetic systems (nanodiscs, amphipols)Native-like conformation preservationMedium-High
Limited high-resolution structuresApplication of cryo-EM to S. granarius COIIAtomic-level binding site informationHigh
Assay throughput constraintsFluorescence-based activity detection100× increase in screening capacityMedium
Genome editing inefficiencyOptimized CRISPR protocols for SitophilusDirect in vivo functional validationHigh
Limited whole-organism studiesMicroinjection and embryo handling protocolsConnection of molecular to organismal phenotypesMedium
  • Data integration frameworks:

    • Development of species-specific databases integrating -omics data

    • Machine learning approaches to identify patterns across experimental platforms

    • Standardized reporting formats for inhibitor screening data

    • Cross-species comparative genomics platforms focused on storage pests

These methodological advances would address current bottlenecks in recombinant COII research, enabling more rapid progress in understanding the fundamental biology of S. granarius and developing targeted control strategies. The integration of cutting-edge technologies from structural biology, functional genomics, and computational science provides a pathway to overcoming the inherent challenges of working with this specialized pest species .

How might climate change impact S. granarius biology and the efficacy of COII-targeted control strategies?

Climate change presents complex challenges for understanding and managing Sitophilus granarius infestations, with significant implications for COII-targeted control strategies:

  • Physiological impacts of climate change on S. granarius:

    • Temperature effects on COII function:

      • Altered enzyme kinetics under elevated temperatures

      • Changes in membrane fluidity affecting COII embedding

      • Potential thermal stress responses impacting mitochondrial function

    • Humidity changes affecting metabolism:

      • Water conservation adaptations (already present due to synanthropic adaptation)

      • Respiratory adjustments in drier conditions

      • Osmoregulatory challenges in fluctuating humidity

  • Geographical distribution shifts:

    • Potential expansion into new regions as climate zones shift

    • Changes in seasonal activity patterns

    • Altered competition dynamics with other storage pests

    • Implications for COII evolution under new selection pressures

  • Control efficacy considerations under climate change scenarios:

Climate FactorImpact on S. granariusEffect on COII BiologyImplications for Control
Increased temperatureAccelerated developmentEnhanced metabolic ratePotentially increased susceptibility to respiratory inhibitors
Decreased humidityStress on water conservationAltered respiratory patternsPossible reduced efficacy of some inhibitors
Temperature fluctuationsPhysiological stressCompensatory metabolic mechanismsNeed for combination approaches
Extended seasonsMore generations per yearSelection pressure on COIIIncreased resistance risk
New geographical rangesNovel environmental adaptationsPossible COII variantsMonitoring for regional differences in susceptibility
  • Adaptation of control strategies:

    • Temperature-specific inhibitor formulations:

      • Optimization for efficacy across broader temperature ranges

      • Thermostable formulations for extreme conditions

    • Integrated approaches considering climate factors:

      • Combination of physical, biological, and chemical controls

      • Climate-informed timing of interventions

      • Predictive modeling for outbreak forecasting

    • Proactive resistance management:

      • Increased monitoring for COII mutations

      • Rotation strategies for different inhibitor classes

      • Development of inhibitors targeting conserved regions less likely to mutate

  • Research priorities under climate change:

    • Thermal performance curves for COII activity

    • Comparative efficacy testing across temperature and humidity gradients

    • Population genomics to track adaptive changes in COII

    • Development of climate-resilient detection and control methods

Understanding these complex interactions between climate change, S. granarius physiology, and COII biology will be essential for developing robust, adaptive pest management strategies that remain effective under changing environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.