Recombinant Smittium culisetae ATP synthase subunit a (atp6)

What is the structural composition of Smittium culisetae ATP synthase subunit a (atp6)?

The recombinant Smittium culisetae ATP synthase subunit a (atp6) is a mitochondrial membrane protein consisting of 245 amino acids (positions 4-248). The mature protein has a molecular weight of approximately 27,680 Da . The amino acid sequence is characterized by multiple transmembrane regions with hydrophobic stretches that anchor the protein within the mitochondrial membrane. The complete amino acid sequence is:

NPLEQFTVNKIISLYTVYYSMSLTNSSLYFIIAAIISFFIFKYSANIPYVSLINKNNYSI
LTESLYKTILKMVKEQIGDKYTIYMPLIFSLFIIILVSNLVGLIPYGFSPTALFALPLGL
SVTIIISVTVIGFVKYHLKYFSVLLPSGTPLGLVPLLLVVELLSYIARAFSLGIRLAANI
TSGHILLNIISGFLFKTSGIALLFVIIPFTLFIALTGLELIVAILQAYVWSILTCIYIKD
SLILH

The protein contains multiple hydrophobic regions consistent with its role as a membrane-embedded component of the ATP synthase complex, where it forms part of the proton channel necessary for ATP synthesis.

How does atp6 contribute to the function of mitochondrial F-ATPase?

ATP synthase subunit a (atp6) is an integral component of the membrane domain of the F-ATPase (ATP synthase) complex. This complex functions as a rotary motor that synthesizes ATP using the energy of the proton-motive force across the mitochondrial inner membrane. Subunit a specifically:

• Forms part of the stator component of the F-ATPase enzyme complex

• Creates a critical interface with the rotating c-ring within the membrane domain

• Provides the transmembrane pathway for protons to pass from the intermembrane space into the mitochondrial matrix

• Contributes to the coupling of proton translocation to ATP synthesis

The subunit remains static relative to the turning of the central rotor and works in conjunction with other membrane subunits to ensure proper enzyme function. Mutations in ATP8, which interacts with atp6, have been shown to uncouple the enzyme and interfere with proper assembly, indicating the critical nature of these membrane subunits .

How has the atp6 gene evolved in fungal mitochondrial genomes?

The atp6 gene in fungal mitochondria demonstrates intriguing evolutionary patterns, particularly in Smittium culisetae and related species:

• Gene Hybridization Events: The atp6 gene in some fungal species has undergone hybridization through the insertion of mobile genetic elements. For example, in Glomus species, atp6 contains an inserted carboxy-terminal duplication coupled with a mobile open reading frame (mORF) encoding an endonuclease .

• Horizontal Gene Transfer (HGT): Evidence suggests that the C-terminal duplications in atp6 originated from other fungal species. The native C-terminal in Glomus sp. shows higher sequence identity (91%) to closely related species like G. irregulare 494, while the duplicated C-terminal shows lower identity (64%), indicating a foreign origin .

• Phylogenetic Analysis: When comparing C-terminal sequences across fungal species, the native C-terminals cluster according to expected phylogeny, while the inserted C-terminals often cluster with more distantly related fungi, further supporting HGT events .

• Intron Dynamics: Mitochondrial introns, including those that may affect atp6, show considerable variation between related fungal species, suggesting rapid mitochondrial genome evolution through invasions of mobile elements .

This complex evolutionary history makes atp6 a valuable marker for studying fungal phylogeny and mitochondrial genome evolution.

What role do mobile genetic elements play in atp6 gene evolution?

Mobile genetic elements play a critical role in the evolution of the atp6 gene in fungal mitochondria:

• Creation of Gene Hybrids: Mobile ORFs (mORFs) encoding endonucleases are responsible for the formation of gene hybrids in atp6 and other mitochondrial genes (atp9, cox2, and nad3) .

• Mechanism of Mobility: These mORFs have been biochemically demonstrated to be responsible for element mobility. They facilitate the insertion of genetic material, including C-terminal duplications .

• Evidence of Expression: The hybrid structures formed by these mobile elements are expressed at the mRNA level, indicating they are functional despite their chimeric nature .

• Evolutionary Impact: The insertion of these elements creates taxonomically informative variation that can be used to design reliable intra- and inter-specific markers for closely related fungal species that otherwise have nearly identical coding sequences .

In Smittium culisetae specifically, the atp6 gene may contain mobile genetic elements that influence its structure and function, contributing to the rapid evolution observed in fungal mitochondrial genomes.

What are the recommended protocols for expressing recombinant S. culisetae atp6 protein?

Based on successful expression systems reported in the literature, researchers should consider the following protocol for expressing recombinant S. culisetae atp6:

• Expression System Selection: E. coli has been successfully used for expression of recombinant S. culisetae ATP synthase subunit a (atp6) . Cell-free expression systems are also viable alternatives for membrane proteins that may be toxic to host cells .

• Vector Design:

  • Include an N-terminal His-tag for purification purposes

  • Consider using a vector with a strong promoter (e.g., T7)

  • Optimize codon usage for the expression host

  • Include the mature protein sequence (amino acids 4-248)

• Expression Conditions:

  • Induce with IPTG at reduced temperatures (16-25°C) to minimize inclusion body formation

  • Consider using speciality E. coli strains designed for membrane protein expression

  • Extended induction times (overnight) at lower temperatures may improve yield

• Protein Extraction and Purification:

  • Use detergent-based lysis buffers containing n-dodecyl-β-d-maltose-neopentyl glycol (0.05% w/v)

  • Purify using metal affinity chromatography (for His-tagged constructs)

  • Consider buffer optimization containing 20 mM HEPES, pH 7.3 with appropriate detergent

• Storage Recommendations:

  • Store in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Alternatively, store in buffer with 50% glycerol

  • Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles

What experimental approaches can be used to study the function of atp6 in ATP synthase complexes?

Several experimental approaches can be employed to study the function of atp6 in ATP synthase complexes:

• Cross-linking Studies:

  • Use bifunctional cross-linking agents to identify interactions between atp6 and other subunits

  • Map labeled lysines onto incomplete structures to understand spatial arrangements

  • Employ isotopically labeled cross-linkers to facilitate identification by mass spectrometry

• ATP Hydrolysis Assays:

  • Measure ATP hydrolytic activity (μmol of ATP hydrolyzed/min/mg)

  • Test sensitivity to oligomycin (0.01% w/v) to assess coupling efficiency of the F0 domain

  • Compare wild-type and mutant forms of the protein to identify functional residues

• Electron Microscopy Studies:

  • Utilize electron cryo-microscopy to determine low-resolution structures

  • Build mosaic structures of the enzyme within the envelope of the entire complex

  • Focus on membrane domain organization and subunit arrangement

• Gene Expression Analysis:

  • Design specific primers for RT-PCR to verify expression at the mRNA level

  • Clone successful RT-PCR products into vectors like pGEM-T Easy Vector Systems

• Functional Reconstitution:

  • Incorporate purified atp6 into liposomes to measure proton translocation

  • Assess the ability to form functional ATP synthase complexes when combined with other subunits

  • Measure proton-motive force generation in the reconstituted system

How can researchers investigate the role of atp6 in mitochondrial gene hybrids?

Investigating the role of atp6 in mitochondrial gene hybrids requires specialized approaches:

• Comparative Genomics Analysis:

  • Sequence mitochondrial genomes from closely related species (e.g., using 454 Titanium Flex shotgun technology)

  • Assemble and annotate using specialized tools like MFannot followed by manual inspection

  • Compare gene order, intron insertion patterns, and presence of mobile genetic elements

• Identification of Hybrid Structures:

  • Perform RT-PCR to verify expression of hybrid transcripts

• Phylogenetic Analysis of C-terminal Regions:

  • Align amino acid sequences using tools like Muscle

  • Remove ambiguous regions with Gblocks

  • Construct maximum likelihood trees using RAxML with appropriate substitution matrices

  • Compare clustering patterns of native versus inserted C-terminals to detect HGT events

• Functional Analysis of Hybrid Proteins:

  • Express recombinant versions of both native and hybrid forms

  • Compare biochemical properties, structure, and function

  • Assess the impact of inserted sequences on ATP synthase assembly and activity

This comprehensive approach allows researchers to understand the evolutionary history, molecular mechanisms, and functional consequences of atp6 gene hybridization events.

What is the significance of trans-splicing in mitochondrial genes like atp6?

Trans-splicing represents a significant post-transcriptional mechanism in mitochondrial gene expression with particular relevance to atp6 and other mitochondrial genes:

• Group I Intron-Mediated Trans-splicing:

  • Split genes like cox1 in some fungi are joined via group I-mediated trans-splicing

  • In this process, two separate RNA precursors are joined together to form a mature mRNA

  • The precursors are brought together by flanking exon sequences that form a group I intron structure

• Evolutionary Implications:

  • Trans-splicing provides a mechanism for gene fragmentation without loss of function

  • It may facilitate horizontal gene transfer by allowing partial gene fragments to be incorporated

  • The presence of trans-splicing machinery may influence the evolution of mitochondrial genes including atp6

• Differences Between Species:

  • Some fragmented genes (like rns) may remain in pieces without trans-splicing

  • Species vary in their capacity for trans-splicing, with some fungi (like Rhizopus oryzae and Smittium culisetae) retaining this capability

• Experimental Detection Methods:

  • RT-PCR using primers that span the predicted joining sites

  • Northern blot analysis to detect mature versus precursor transcripts

  • RNA sequencing to identify splice junctions and potential intermediates

Understanding trans-splicing mechanisms is crucial for comprehending the complex post-transcriptional processing of mitochondrial transcripts and may provide insights into the functional expression of hybrid genes like atp6.

What are the challenges in purifying membrane proteins like atp6, and how can they be overcome?

Purification of membrane proteins like atp6 presents several challenges due to their hydrophobic nature and membrane integration:

• Solubilization Challenges:

  • Problem: Conventional aqueous buffers cannot solubilize membrane proteins

  • Solution: Use specialized detergents like n-dodecyl-β-d-maltose-neopentyl glycol (0.05% w/v) that have been demonstrated to maintain ATP synthase activity and integrity

• Protein Stability:

  • Problem: Membrane proteins often denature when removed from their native lipid environment

  • Solution: Include stabilizing agents like trehalose (6%) in storage buffers or maintain high glycerol concentrations (50%)

• Expression Yield:

  • Problem: Toxic effects on host cells when overexpressing membrane proteins

  • Solution: Consider cell-free expression systems or use specialized E. coli strains designed for membrane protein expression with tightly regulated induction systems

• Protein Folding:

  • Problem: Improper folding leading to inclusion body formation

  • Solution: Express at lower temperatures (16-25°C), use fusion partners that enhance solubility, or develop refolding protocols from inclusion bodies

• Functional Assessment:

  • Problem: Difficult to assess if purified protein retains native structure

  • Solution: Perform ATP hydrolysis assays with oligomycin sensitivity testing (95-99% inhibition indicates properly coupled F0 domain)

• Long-term Storage:

  • Problem: Protein aggregation during storage

  • Solution: Avoid repeated freeze-thaw cycles by storing working aliquots at 4°C for up to one week and long-term storage at -20°C/-80°C

A comprehensive approach combining appropriate detergent selection, expression system optimization, and careful buffer composition can significantly improve the purification outcomes for challenging membrane proteins like atp6.

How can researchers verify the authenticity and activity of recombinant atp6 protein?

Verifying the authenticity and activity of recombinant atp6 requires multiple complementary approaches:

• Protein Identification and Purity Assessment:

  • SDS-PAGE analysis to confirm molecular weight (27,680 Da)

  • Western blotting using anti-His antibodies (for His-tagged constructs)

  • Mass spectrometry to verify protein sequence coverage

  • Purity assessment (aim for >85-90% as determined by SDS-PAGE)

• Structural Verification:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Limited proteolysis to evaluate proper folding

  • Thermal shift assays to determine protein stability

• Functional Assays:

  • Integration into liposomes to measure proton translocation

  • Reconstitution with other ATP synthase subunits to assess complex formation

  • ATP hydrolysis assays with inhibitor sensitivity testing to verify functional coupling

• Interaction Studies:

  • Pull-down assays to verify interaction with known binding partners

  • Cross-linking studies with other subunits of the ATP synthase complex

  • Surface plasmon resonance to quantify binding to other components

• Activity Comparison:

  • Comparative analysis with native ATP synthase complexes

  • Measurement of ATP hydrolytic activity (μmol of ATP hydrolyzed/min/mg)

  • Oligomycin sensitivity (95-99% inhibition indicates properly coupled F0 domain)

These complementary approaches provide robust verification of protein authenticity and functional activity, ensuring that experimental results obtained with the recombinant protein accurately reflect the biological properties of native atp6.

How does the study of S. culisetae atp6 contribute to our understanding of mitochondrial evolution?

The study of S. culisetae atp6 offers unique insights into mitochondrial evolution through several key aspects:

• Evolutionary Marker: As part of the mitochondrial genome, atp6 provides valuable phylogenetic information for understanding the evolutionary relationships among fungal species .

• Mobile Genetic Elements: The presence of mobile ORFs in atp6 and other mitochondrial genes illustrates mechanisms of rapid mitochondrial genome evolution through invasion of mobile elements .

• Horizontal Gene Transfer: Evidence of HGT in atp6 genes, as demonstrated by C-terminal duplications with foreign origins, reveals an important mechanism for genetic diversity in mitochondrial genomes .

• Gene Hybridization: The formation of gene hybrids in atp6 through mobile element insertion shows how mitochondrial genes can acquire new sequences while maintaining function .

• Trans-splicing Potential: The study of fragmented genes and their expression may reveal trans-splicing mechanisms similar to those demonstrated in cox1 genes of related fungi .

• Divergent Intron Patterns: Comparison of intron insertion patterns between closely related species provides insight into the mechanisms of mitochondrial genome diversification .

By studying these aspects of S. culisetae atp6, researchers gain a deeper understanding of the dynamic nature of mitochondrial evolution, particularly in fungal lineages, and the mechanisms that drive genetic diversity in these essential organelles.

What can we learn about energy metabolism from studying the structure-function relationship of atp6?

Studying the structure-function relationship of atp6 provides critical insights into energy metabolism:

• Proton Translocation Mechanism:

  • Atp6 (subunit a) forms the critical interface with the c-ring, providing the transmembrane pathway for protons

  • Understanding this interface reveals how proton movement is coupled to mechanical rotation

  • This elucidates the fundamental mechanism by which the proton-motive force is converted to ATP synthesis

• Regulatory Mechanisms:

  • The F-ATPase complex can function bidirectionally - as ATP synthase in clockwise rotation or as a proton-pumping ATP hydrolase in counterclockwise rotation

  • Regulatory mechanisms appear to function by avoiding ATP hydrolysis while preserving ATP synthesis

  • Understanding atp6's role provides insight into these regulatory processes

• Evolutionary Adaptations:

  • Different organisms show adaptations in ATP synthase components, including atp6

  • These adaptations may reflect environmental pressures and metabolic requirements

  • Comparative studies reveal how energy metabolism has evolved across different lineages

• Disease Implications:

  • Mutations in atp6 and other ATP synthase components can lead to metabolic disorders

  • Studying the structure-function relationship helps understand the molecular basis of these conditions

  • This may lead to therapeutic strategies for mitochondrial diseases

• Bioenergetic Efficiency:

  • The precise arrangement of atp6 and other subunits determines the efficiency of ATP production

  • Understanding this arrangement provides insights into bioenergetic optimization

  • This knowledge may inform synthetic biology approaches to enhance or modify energy metabolism

The detailed understanding of atp6's structure-function relationship thus provides fundamental insights into the molecular machinery of cellular energy production, with implications for health, disease, and biotechnological applications.