Recombinant Smittium culisetae Cytochrome c oxidase subunit 2 (cox2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cox2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Zancudomyces culisetae (Gut fungus) (Smittium culisetae)
Target Names
cox2
Target Protein Sequence
MNIFSFYIINNDAPEPWQICYQDSATKIMSGIDKLTGEIFYYETLLLIIVGWVLISAIIK YTKTELSYKYFNHGTLIEILWTCSPAFILIAISFPSFKLLYLMDSIIDSQITIKVLGHQW YWSYEYSDYLDNSGDSISFDSIMIPTDDLEPGQFRLLEVDNRIVLPIHTHIRFICTSSDV IHSFAVPSLGLKIDALPGRLNGISTYVEREGTFYGQCSELCGVYHFGMPIVIEAVRIEKY LEWLNIHLDNTPSS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation by facilitating the transfer of electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, which powers ATP synthesis. COX2, along with three other multi-subunit complexes (complexes I, II, and III), cooperatively transfers electrons. Within COX2, electrons are transferred from reduced cytochrome c via the Cu(A) center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, comprising heme a3 and Cu(B). The BNC catalyzes the reduction of molecular oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Smittium culisetae and how has its taxonomic classification evolved?

Smittium culisetae is an endosymbiotic microfungus belonging to the order Harpellales. The fungus inhabits the digestive tracts of larval aquatic insects, particularly lower Diptera species. Following 75 years of Smittium research, molecular studies have demonstrated that Smittium is polyphyletic, with Smittium culisetae consistently separating from other Smittium species in phylogenetic analyses. This evidence has led to its reclassification as Zancudomyces culisetae, establishing a new genus to accommodate this widely distributed species . The taxonomic revision was supported by combined molecular evidence from both 18S and 28S rRNA gene sequence data, which demonstrated that Z. culisetae forms a distinct cluster separate from Smittium species .

What is the function of cytochrome c oxidase subunit 2 in fungal mitochondria?

Cytochrome c oxidase subunit 2 (cox2) is a key component of the mitochondrial respiratory chain. While specific information on the fungal protein is limited in the provided sources, we can infer its function from homologous proteins. In organisms like Thermus thermophilus, subunits I and II form the functional core of the enzyme complex. The protein facilitates electron transfer, with electrons originating in cytochrome c being transferred via heme a and Cu(A) to the binuclear center formed by heme a3 and Cu(B) . In fungi such as Parasitella parasitica, cox2 can be split or duplicated , suggesting potential functional adaptations. The cox2 gene is encoded in the mitochondrial genome and is essential for cellular respiration and energy production in eukaryotic organisms.

How is recombinant Smittium culisetae cox2 typically produced for research applications?

Recombinant Smittium culisetae cox2 is produced through molecular cloning and heterologous expression systems. While specific production details are not extensively covered in the provided sources, recombinant proteins for research are typically created by isolating the gene of interest from the organism, cloning it into an appropriate expression vector, and expressing it in a host system such as E. coli, yeast, or insect cells. The recombinant protein is then purified using affinity chromatography or other purification techniques. Commercial preparations are available from suppliers like MyBioSource and other research reagent companies , typically provided in buffer solutions such as Tris-base to maintain protein stability .

How can recombinant Smittium culisetae cox2 be used for evolutionary and phylogenetic studies?

Recombinant Smittium culisetae cox2 serves as an important molecular marker for evolutionary and phylogenetic studies, particularly in understanding the relationships within the Harpellales order. Researchers can use this protein or its encoding gene to:

  • Conduct comparative analyses with cox2 from related fungal species to establish evolutionary relationships

  • Develop molecular clocks for dating divergence events within fungal lineages

  • Study the evolution of mitochondrial gene arrangements and duplications

The cox2 gene has been particularly valuable in resolving the taxonomic position of Smittium culisetae, supporting its reclassification as Zancudomyces culisetae . When combined with other molecular markers such as 18S and 28S rRNA, cox2 provides robust phylogenetic signal for fungal systematic studies. Researchers should employ maximum likelihood or Bayesian inference methods for phylogenetic analysis, similar to the Tamura-Nei-based Maximum Likelihood approach described for related molecular studies .

What experimental approaches can be used to study the functional differences between cox2 from Smittium culisetae and related fungal species?

To investigate functional differences between cox2 from Smittium culisetae and related fungi, researchers can employ several approaches:

  • Comparative Enzyme Kinetics Analysis: Measure and compare the catalytic efficiency, substrate affinity, and reaction rates of recombinant cox2 from multiple fungal species under standardized conditions.

  • Structural Biology Studies: Determine the three-dimensional structure of the proteins using X-ray crystallography or cryo-electron microscopy to identify structural differences that may explain functional variations.

  • Site-Directed Mutagenesis: Create targeted mutations in the cox2 sequence to identify critical residues that contribute to species-specific functions or adaptations.

  • Heterologous Expression Systems: Express the cox2 gene from different fungal species in a common host to assess functional complementation and isolate species-specific properties.

  • Comparative Transcriptomics: Analyze expression patterns of cox2 and associated genes across different fungal species to identify regulatory differences.

These approaches would help elucidate how evolutionary adaptations in cox2 might contribute to the unique ecological niche of Smittium culisetae as an endosymbiont of aquatic insect larvae.

How can recombinant cox2 be incorporated into host-parasite interaction studies involving Smittium culisetae?

Recombinant cox2 can be utilized in several experimental designs to study the host-parasite interactions between Smittium culisetae and its insect hosts:

  • Immunolocalization Studies: Using antibodies raised against recombinant cox2, researchers can track the distribution and dynamics of mitochondria during infection and colonization of the insect gut.

  • Molecular Probe Development: Similar to approaches used with other fungi, the recombinant protein or corresponding gene sequences can be used to develop parasite-specific hybridization probes to study post-infection behavior directly at the level of organelles .

  • Cross-Feeding Experiments: Design experiments to investigate how the respiratory function of cox2 might be influenced by the host environment, potentially contributing to the fungus's adaptation to the insect gut.

  • Comparative Analyses with Insect cox2: Study potential molecular mimicry or interference with host mitochondrial function by comparing the fungal cox2 with the homologous protein from host insects.

These approaches would build on the established knowledge that Smittium species inhabit the digestive tracts of larval aquatic insects , providing insights into the molecular mechanisms underlying this specialized ecological relationship.

What protein purification strategies are most effective for obtaining high-purity recombinant Smittium culisetae cox2?

While the search results don't specify purification protocols for this particular protein, effective purification strategies for recombinant mitochondrial proteins like cox2 typically include:

  • Affinity Chromatography: Using a fusion tag (His, GST, or MBP) to enable selective binding to an affinity resin.

  • Ion Exchange Chromatography: Exploiting the protein's charge properties for purification, particularly useful as a secondary purification step.

  • Size Exclusion Chromatography: Separating the target protein based on molecular size, especially valuable for removing aggregates and obtaining homogeneous protein samples.

  • Detergent Solubilization: Since cox2 is a membrane protein, appropriate detergents must be selected to maintain protein structure and function during purification.

  • Buffer Optimization: Testing various buffer conditions (pH, salt concentration, stabilizing agents) to maximize protein stability.

The appropriate tag type should be determined during the production process , as different tags may affect protein folding, solubility, and activity. Purified protein is typically stored in a stabilizing buffer such as Tris-base with appropriate additives to maintain long-term stability.

What are the optimal conditions for assessing the enzymatic activity of recombinant Smittium culisetae cox2?

To assess the enzymatic activity of recombinant Smittium culisetae cox2, researchers should consider the following conditions and approaches:

  • Assay Buffer Composition:

    • pH range: 6.5-7.5 (optimal for most cytochrome c oxidase activity)

    • Ionic strength: 50-150 mM KCl or NaCl

    • Presence of divalent cations: 1-5 mM Mg²⁺ or Mn²⁺

  • Substrate Considerations:

    • Use reduced cytochrome c as the electron donor

    • Ensure oxygen availability as the terminal electron acceptor

    • Control substrate concentrations to enable Michaelis-Menten kinetic analysis

  • Activity Measurement Techniques:

    • Spectrophotometric assays monitoring cytochrome c oxidation at 550 nm

    • Oxygen consumption measurements using polarographic electrodes

    • Coupling enzyme assays that link cox2 activity to easily measurable reactions

  • Temperature and Time Parameters:

    • Test activity across a temperature range (25-45°C) to determine the optimal temperature

    • Include time-course measurements to ensure linearity of the reaction

  • Controls and Validations:

    • Include enzyme-free and substrate-free controls

    • Use known inhibitors to confirm specificity of the measured activity

    • Compare with activity of cox2 from related organisms as benchmarks

These parameters should be systematically optimized for the specific recombinant preparation to ensure reliable and reproducible activity measurements.

What are the best approaches for generating antibodies against Smittium culisetae cox2 for immunodetection studies?

For generating effective antibodies against Smittium culisetae cox2, researchers should consider these approaches:

  • Antigen Preparation Options:

    • Use full-length recombinant protein for polyclonal antibody production

    • Identify unique, surface-exposed epitopes for peptide-based antibody generation

    • Consider using conserved regions for broader cross-reactivity or unique regions for specificity

  • Host Selection for Antibody Production:

    • Rabbits for polyclonal antibodies (good general-purpose option)

    • Mice or rats for monoclonal antibody development (when highest specificity is required)

    • Chickens for IgY antibodies (to minimize cross-reactivity with mammalian proteins)

  • Validation Strategies:

    • Western blot analysis with recombinant protein and native extracts

    • Immunoprecipitation followed by mass spectrometry

    • Immunohistochemistry with known positive and negative control tissues

    • Pre-absorption controls with immunizing antigen

  • Applications-Specific Considerations:

    • For subcellular localization, affinity-purify antibodies against the immunizing antigen

    • For quantitative assays like ELISA, determine linear range and detection limits

    • For tracking protein in insect host tissue, test for cross-reactivity with host proteins

The choice between monoclonal and polyclonal antibodies should be guided by the specific research questions, with monoclonals offering higher specificity but potentially limited epitope recognition, while polyclonals provide robust detection across multiple epitopes.

How does the structure and function of cox2 differ between Smittium culisetae and the reclassified Zancudomyces culisetae?

This question addresses a nomenclature issue rather than a biological difference. Smittium culisetae and Zancudomyces culisetae refer to the same organism before and after taxonomic reclassification, respectively. Molecular studies, including analyses of 18S and 28S rRNA gene sequences, demonstrated that Smittium culisetae consistently separates from other Smittium species in phylogenetic analyses . This evidence led to the establishment of a new genus, Zancudomyces, to accommodate this species. Therefore, the cox2 protein from both named entities is identical, as they represent the same biological organism. The reclassification reflects our improved understanding of fungal phylogeny rather than a difference in the protein itself. Researchers should be aware of this taxonomic update when reviewing literature and designing comparative studies.

How do mitochondrial gene arrangements involving cox2 differ between Smittium culisetae and other fungal species?

The mitochondrial gene arrangements involving cox2 show notable differences between Smittium culisetae (now Zancudomyces culisetae) and other fungal species:

  • Gene Duplication Patterns: In fungi like Parasitella parasitica, cox2 is among several genes (including cox1, cox3, cob, nad1, nad5, nad6) that can be split or duplicated . This contrasts with the organization in Zancudomyces culisetae, which may have different patterns of gene duplication or splitting.

  • Chondriome Size Variations: Zancudomyces culisetae has a chondriome (mitochondrial genome) size of approximately 58,654 bp , which is smaller than the 83,361 bp found in Parasitella parasitica . This size difference reflects variations in gene content, intron presence, and non-coding regions.

  • Homing Endonuclease Distribution: Zancudomyces culisetae has 13 genes for homing nucleases , which can influence the organization and evolution of mitochondrial genes including cox2. This differs from other fungi like Phycomyces blakesleeanus (12 homing endonuclease genes) and Mucor verticillata (6 homing endonuclease genes) .

These differences in mitochondrial gene arrangements provide valuable insights into the evolutionary history and potential functional adaptations of these fungi to their specific ecological niches.

What are the key methodological differences when working with cox2 from Smittium culisetae compared to homologous proteins from model organisms?

Working with cox2 from Smittium culisetae presents several methodological challenges compared to homologous proteins from model organisms:

Methodological AspectSmittium culisetae cox2Model Organism cox2 (e.g., Saccharomyces cerevisiae)
Gene isolationRequires specialized cultivation of the fungus from insect gut environmentsCan be readily obtained from standardized laboratory cultures
Expression systemsMay require optimization due to potential codon usage biasWell-established protocols with optimized codons for common expression hosts
Functional assaysFew established assays specific to this organism's proteinStandardized activity assays with established parameters and controls
Antibody availabilityLimited commercial options, may require custom developmentOften commercially available antibodies exist
Structural informationLimited or absent structural dataOften have crystal structures or models available
Genetic manipulationChallenging due to limited genetic tools for HarpellalesWell-developed genetic modification techniques available

Researchers must account for these differences when designing experiments. For example, when expressing recombinant Smittium culisetae cox2, codon optimization for the expression host may be necessary to improve yield. Additionally, functional assays may need to be adapted from those established for model organisms, with careful validation to ensure they accurately reflect the activity of the Smittium protein.

How can recombinant Smittium culisetae cox2 be used in comparative studies with cox2 from mosquito hosts?

Recombinant Smittium culisetae cox2 can be leveraged in several ways for comparative studies with cox2 from mosquito hosts:

  • Structural and Functional Comparisons:

    • Conduct comparative enzyme kinetics to identify differences in catalytic properties

    • Perform protein-protein interaction studies to determine if fungal cox2 interacts differently with other respiratory components compared to the host version

    • Compare substrate specificity and inhibitor sensitivity profiles

  • Co-evolution Analysis:

    • Align sequences from multiple Smittium species and their respective insect hosts to identify co-evolutionary patterns

    • Examine selection pressures on specific residues or domains using dN/dS ratio analysis

    • Investigate if long-term associations have led to convergent adaptations

  • Host-Parasite Interaction Studies:

    • Examine if fungal cox2 competes with or complements host cox2 function

    • Investigate potential molecular mimicry by comparing epitope structures

    • Study if the fungal protein influences host mitochondrial function during colonization

  • Application in Molecular Ecology:

    • Develop molecular markers based on cox2 sequence differences for rapid identification of specific fungal-host associations

    • Create specific probes to track the distribution of these associations in natural populations

This comparative approach is particularly relevant given that Smittium species inhabit the digestive tracts of larval aquatic insects, including mosquitoes , and certain mosquito species like Culiseta longiareolata are known to transmit diseases such as avian malaria and West Nile fever .

What are the potential applications of Smittium culisetae cox2 in understanding mitochondrial inheritance in fungi?

Recombinant Smittium culisetae cox2 and its encoding gene offer valuable tools for investigating mitochondrial inheritance patterns in fungi:

  • Uniparental Inheritance Studies: The cox2 gene can serve as a marker to track mitochondrial inheritance in genetic crosses. This approach is particularly valuable given that mitochondria are known to be uniparentally inherited in some zygomycetes like Phycomyces blakesleeanus .

  • Mitochondrial Fusion and Recombination: Cox2 can be used to develop experimental approaches that follow the fate of mitochondria after infection or during mating, providing insights into organelle dynamics during these processes .

  • Selective Pressure Analysis: Comparing cox2 sequences across multiple generations can reveal selective pressures acting on mitochondrial genes during inheritance.

  • Heteroplasmy Investigation: The gene can be used to study potential heteroplasmy (presence of multiple mitochondrial genotypes) in fungal populations and its effects on fitness.

These applications build on the understanding that the mitochondrial sequence "constitutes the starting point for experimental approaches that follow the fate of mitochondria after infection" , and can leverage parasite-specific hybridization probes to study mitochondrial behavior directly at the level of organelles.

How might research on Smittium culisetae cox2 contribute to understanding broader ecological relationships in aquatic ecosystems?

Research on Smittium culisetae cox2 can provide insights into complex ecological relationships in aquatic ecosystems through several research avenues:

  • Food Web Dynamics: By studying the energy metabolism of this endosymbiont through cox2 function, researchers can better understand how these fungi contribute to energy flow in aquatic food webs, particularly in the context of insect larval development.

  • Host Range Determination: Cox2-based molecular markers can be used to investigate the host specificity of Smittium culisetae across different insect species, providing insights into co-evolutionary relationships.

  • Environmental Adaptation Mechanisms: Studying functional adaptations in cox2 can reveal how the fungus has adapted to the specific microenvironment of insect digestive tracts, potentially identifying novel respiratory adaptations.

  • Biomonitoring Applications: Cox2 sequences could serve as genetic markers for monitoring the presence and distribution of these fungi in aquatic ecosystems, potentially serving as indicators of water quality or insect population health.

  • Disease Vector Ecology: Given that Smittium culisetae inhabits the digestive tracts of larval aquatic insects, including mosquitoes that can transmit diseases like West Nile fever , understanding this relationship may contribute to vector control strategies.

This research direction is particularly significant considering the role that mosquitoes like Culiseta longiareolata play in the transmission of avian malaria, tularemia, and arboviral diseases , potentially establishing connections between fungal endosymbionts and vector competence.

What novel biotechnological applications might emerge from detailed structural and functional studies of Smittium culisetae cox2?

Detailed structural and functional characterization of Smittium culisetae cox2 could lead to several biotechnological applications:

  • Enzyme Engineering: Understanding the unique properties of this cox2 could enable the engineering of improved cytochrome oxidases with enhanced stability or catalytic efficiency for biotechnological applications.

  • Biomarker Development: The protein could serve as a foundation for developing specific biomarkers for detecting and monitoring endosymbiotic fungi in environmental samples or insect populations.

  • Biocatalysis Applications: Identifying unique catalytic properties could lead to applications in biocatalysis, potentially enabling novel oxidation reactions in industrial processes.

  • Anti-fungal Target Identification: Structural differences between fungal and host cox2 proteins could reveal targets for selective inhibition, potentially leading to novel anti-fungal strategies.

  • Biosensor Development: The electron transfer capabilities of cox2 could be exploited to develop biosensors for detecting specific environmental conditions or compounds.

While not directly related to the fungal cox2, research in the broader field of COX proteins has demonstrated the potential for developing imaging probes, such as the 18F-labeled COX2 probes developed for cancer imaging . Similar approaches could potentially be adapted for ecological or environmental monitoring applications involving fungal endosymbionts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.