Recombinant sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Functional Role

UgpA operates within the Ugp transporter complex (UgpABCEQ), which facilitates G3P uptake under phosphate-limited conditions . Key functional insights include:

  • Regulation: Expression is controlled by the pho regulon, activated during phosphate starvation .

  • Mechanism: Acts as a permease, translocating G3P across the cytoplasmic membrane in an ATP-dependent manner .

  • Substrate Specificity: Transports G3P and its toxic analogs (e.g., 3,4-dihydroxybutyl-1-phosphonate) .

  • Metabolic Role: Transported G3P is incorporated into phospholipids but cannot serve as a sole carbon source .

Research Applications

Recombinant UgpA is widely used to study:

  1. Bacterial Phosphate Metabolism: Elucidating G3P transport mechanisms under nutrient stress .

  2. ABC Transporter Dynamics: Structural and functional analyses of membrane protein complexes .

  3. Drug Development: Screening inhibitors targeting phosphate uptake pathways in pathogens like Y. pestis and M. tuberculosis .

Key Research Findings

  • Genetic Mapping: In E. coli, ugpA and ugpB (encoding the binding protein) are located at 75.3 min on the chromosome .

  • Functional Redundancy: M. tuberculosis UgpA homologs (e.g., Rv2835c) are non-essential under standard growth but critical in phosphate-scarce environments .

  • Environmental Prevalence: Ugp transporters are abundant in marine bacteria, suggesting ecological roles in phosphorus cycling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we will accommodate specific format requirements. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
ugpA; Ecok1_34290; APECO1_3007; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Escherichia coli O1:K1 / APEC
Target Names
ugpA
Target Protein Sequence
MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFV TLFHDSYYLDAFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPA VAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAA LQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSG GPVQATTTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQFRYVESKVRYQ
Uniprot No.

Target Background

Function
This protein is part of the binding-protein-dependent transport system for sn-glycerol-3-phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, UgpAE subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the ugp-dependent transport system and what role does ugpA play in it?

The ugp-dependent transport system is a specialized bacterial transport system responsible for the uptake of sn-glycerol-3-phosphate in conditions of phosphate starvation. This system functions as a binding protein-dependent transport mechanism that is highly sensitive to osmotic shock and does not operate in membrane vesicles . The ugpA protein serves as a crucial permease component within this multiprotein complex, spanning the bacterial inner membrane and participating in the translocation of sn-glycerol-3-phosphate molecules from the periplasmic space into the cytoplasm.

The transport system requires a periplasmic binding protein which is necessary but not sufficient for transport activity, as demonstrated through the isolation of transport mutants lacking this binding protein . The ugpA permease works in concert with other Ugp proteins to facilitate the complete transport process, forming a channel through which the substrate can pass after initial capture by the binding protein.

How is the ugp-dependent transport system regulated in bacteria?

The ugp-dependent transport system is primarily regulated in response to phosphate availability in the environment. The system is specifically induced under conditions of phosphate starvation and in mutants that are constitutive for the pho regulon . This regulatory pattern indicates that the ugp system serves as an adaptive mechanism for bacteria to obtain phosphate from alternative sources when inorganic phosphate is limited.

What methodological approaches are most effective for studying ugpA expression?

When studying ugpA expression, researchers should consider multiple complementary methodological approaches:

  • Transcriptional analysis: Quantitative PCR and RNA-Seq can accurately measure ugpA mRNA levels under various experimental conditions, providing insight into transcriptional regulation.

  • Reporter gene fusion: Creating ugpA-reporter gene fusions (such as lacZ or GFP) allows for real-time monitoring of ugpA promoter activity in response to environmental stimuli.

  • Proteomic analysis: Western blotting with specific antibodies against ugpA and mass spectrometry-based approaches enable quantification of protein expression levels.

  • Experimental design considerations: When designing experiments to study ugpA expression, researchers should include:

    • Proper controls for phosphate availability

    • Time-course measurements to capture dynamic expression changes

    • Validation across multiple bacterial strains to ensure generalizability

The validity of expression studies relies heavily on robust experimental design that incorporates biologic variation and systematic controls, with attention to sampling protocols that provide better estimates of variation within the data .

How can researchers distinguish between ugpA function and other phosphate transport systems?

Distinguishing ugpA function from other phosphate transport systems requires specific experimental strategies:

ApproachMethodologyKey Advantages
Genetic manipulationCreation of ugpA knockout mutantsIsolates ugpA-specific effects
Transport assaysMeasurement of sn-glycerol-3-phosphate uptakeQuantifies specific substrate transport
Competitive inhibition studiesUse of 3,4-dihydroxybutyl-1-phosphonateSpecifically blocks ugp-dependent transport
Osmotic shock treatmentReleases periplasmic binding proteinsDifferentiates binding protein-dependent systems

Researchers have successfully isolated ugp transport mutants by selecting for resistance against the toxic analog 3,4-dihydroxybutyl-1-phosphonate, which is transported by the ugp system . This approach provides a powerful tool for distinguishing ugpA-mediated transport from other phosphate acquisition mechanisms.

What growth conditions are optimal for studying ugpA function?

For optimal study of ugpA function, researchers should establish growth conditions that specifically induce and enable detection of the ugp transport system:

  • Phosphate limitation: Growth media should contain limited phosphate to induce the pho regulon and subsequently the ugp transport system .

  • Alternative carbon source: Because sn-glycerol-3-phosphate transported via ugp cannot be used as the sole carbon source, an alternative carbon source must be provided in the growth medium .

  • Bacterial strain selection: Utilize strains constructed to lack alkaline phosphatase and glycerol kinase while being constitutive for the glp regulon, as these modifications enhance detection of ugp-dependent transport .

  • Radiolabeling experiments: For metabolic tracking, incorporate [14C]sn-glycerol-3-phosphate into experimental designs, as this enables monitoring of phosphate incorporation into cellular components .

What experimental design considerations are critical when studying interactions between ugpA and other components of the transport system?

Studying interactions between ugpA and other transport system components requires careful experimental design:

How can researchers address data contradictions in ugpA transport activity measurements?

Addressing contradictions in ugpA transport activity data requires systematic analysis and methodological rigor:

  • Sources of potential contradictions:

    • Variations in experimental conditions (pH, temperature, ionic strength)

    • Differences in bacterial strain backgrounds

    • Inconsistent induction of the pho regulon

    • Variability in periplasmic binding protein availability

  • Resolution approaches:

    • Standardize experimental conditions across laboratories

    • Implement robust controls for phosphate availability

    • Apply GRADE methodology (Grading of Recommendations Assessment, Development and Evaluation) to evaluate evidence quality

    • Conduct systematic replication studies with attention to variables that might explain contradictions

  • Data integration strategies:

    • Meta-analysis of multiple independent studies

    • Development of mathematical models to reconcile apparently contradictory findings

    • Application of Bayesian approaches to update understanding based on new evidence

The GRADE approach can be particularly valuable, as it specifies four levels of certainty for a body of evidence: high, moderate, low, and very low . Assessment through consideration of risk of bias, inconsistency, indirectness, imprecision, and publication bias can help researchers evaluate contradictory findings.

What advanced techniques enable structural characterization of ugpA in membrane environments?

Structural characterization of membrane-embedded ugpA requires specialized techniques:

  • Cryo-electron microscopy (cryo-EM):

    • Enables visualization of ugpA within the membrane context

    • Can resolve interactions with other transport system components

    • Preserves native lipid environment

  • Solid-state NMR spectroscopy:

    • Provides atomic-level information about ugpA structure

    • Can detect conformational changes during transport

    • Works with membrane-embedded proteins

  • Molecular dynamics simulations:

    • Models ugpA behavior within phospholipid bilayers

    • Predicts substrate binding sites and conformational changes

    • Complements experimental approaches by testing mechanistic hypotheses

  • X-ray crystallography with lipidic cubic phase:

    • Enables crystallization of membrane proteins

    • Provides high-resolution structural data

    • May require protein engineering to enhance crystallizability

These techniques should be employed in combination to develop a comprehensive structural understanding of ugpA function, as each approach has distinct strengths and limitations.

How can genetic manipulation of ugpA contribute to understanding phosphate metabolism?

Genetic manipulation of ugpA offers powerful insights into phosphate metabolism:

  • Site-directed mutagenesis approaches:

    • Targeting conserved residues to identify functional domains

    • Creating chimeric proteins to map substrate specificity determinants

    • Introducing reporter tags for localization and interaction studies

  • Regulatory element manipulation:

    • Modifying ugpA promoter regions to alter expression patterns

    • Creating constitutive expression systems to study ugpA function independent of phosphate limitation

    • Developing inducible systems for temporal control of expression

  • System-wide effects analysis:

    • Transcriptomic profiling of ugpA mutants under phosphate limitation

    • Metabolomic analysis to track phosphate flux in modified strains

    • Proteomic studies to identify compensatory mechanisms

When cells are grown with an alternate carbon source, sn-glycerol-3-phosphate transported via the ugp system can be incorporated into cellular components . Genetic manipulation enables researchers to trace these metabolic pathways and understand how phosphate is distributed within the cell.

What statistical approaches are recommended for analyzing ugpA transport kinetics?

Analysis of ugpA transport kinetics requires appropriate statistical methodologies:

  • Kinetic parameter estimation:

    • Non-linear regression for determining Km and Vmax values

    • Comparison of different kinetic models (Michaelis-Menten, Hill equation, etc.)

    • Bootstrap resampling to establish confidence intervals

  • Comparative analysis:

    • ANOVA for comparing transport rates under different conditions

    • Mixed-effects models for analyzing data with multiple sources of variation

    • Multiple comparison corrections (e.g., Bonferroni, Tukey) to control false discovery rate

  • Time-series analysis:

    • Repeated measures designs for tracking transport over time

    • Area under the curve calculations for cumulative transport assessment

    • Mathematical modeling of transport dynamics

When designing experiments to analyze transport kinetics, power calculations would be desirable but may be limited by uncertainties about the variability inherent in the assays and interdependencies among the system components .

How should researchers validate findings on ugpA function across experimental systems?

Cross-validation of ugpA findings requires systematic methodological approaches:

A carefully designed database containing toxicogenomic data along with structure-activity relationships and information about dose-response would allow questions about reproducibility, reliability, and generalizability to be more fully addressed .

What approaches help interpret changes in ugpA expression under different experimental conditions?

Interpretation of ugpA expression changes requires multifaceted analysis:

  • Contextual analysis:

    • Correlation with phosphate availability

    • Examination of co-regulated genes in the pho regulon

    • Consideration of growth phase and metabolic state

  • Integrated data visualization:

    • Heat maps showing expression patterns across conditions

    • Principal component analysis to identify major sources of variation

    • Network analysis to identify functional relationships

  • Quantitative framework:

    • Establish thresholds for biological significance

    • Calculate fold-changes relative to appropriate controls

    • Determine statistical significance with consideration of multiple testing

  • Causal inference:

    • Design experiments that distinguish correlation from causation

    • Implement perturbation studies to test mechanistic hypotheses

    • Apply directed acyclic graphs to model causal relationships

The ugp system is induced under conditions of phosphate starvation and in mutants that are constitutive for the pho regulon , providing a foundation for interpreting expression changes in the context of cellular phosphate status.

How can understanding ugpA function inform broader bacterial adaptation mechanisms?

Understanding ugpA function provides insights into bacterial adaptation:

  • Stress response mechanisms:

    • The ugp system represents a specialized adaptation to phosphate limitation

    • Study of ugpA regulation reveals how bacteria sense and respond to nutrient stress

    • Comparison with other nutrient acquisition systems illuminates common adaptive principles

  • Metabolic flexibility:

    • ugpA-mediated transport illustrates bacterial capacity to utilize alternative phosphate sources

    • Integration with carbon metabolism demonstrates metabolic network interconnections

    • Utilization of transported sn-glycerol-3-phosphate for phospholipid synthesis highlights resource allocation strategies

  • Regulatory network architecture:

    • The pho regulon control of ugpA expression exemplifies hierarchical regulation

    • Cross-talk between phosphate and carbon utilization pathways reveals regulatory integration

    • Feedback mechanisms controlling transport activity demonstrate homeostatic regulation

The finding that sn-glycerol-3-phosphate transported via ugp cannot be used as the sole carbon source but can serve as a phosphate source when an alternate carbon source is present illustrates the specialized nature of this adaptation mechanism.

What methodological innovations might enhance future ugpA research?

Future ugpA research will benefit from methodological innovations:

  • Single-cell techniques:

    • Microfluidic systems for monitoring individual bacterial responses

    • Single-cell RNA-seq to capture population heterogeneity

    • High-resolution microscopy to track protein localization and dynamics

  • In situ structural studies:

    • Developments in cellular cryo-electron tomography

    • Advanced labeling techniques for super-resolution microscopy

    • Evolution of solid-state NMR for membrane protein analysis

  • Systems biology approaches:

    • Multi-omics integration to connect genotype to phenotype

    • Machine learning for pattern recognition in complex datasets

    • Genome-scale metabolic models incorporating transport kinetics

  • Synthetic biology tools:

    • CRISPR-Cas9 for precise genetic manipulation

    • Optogenetic control of ugpA expression

    • Biosensors for real-time monitoring of transport activity

The greatest challenge of toxicogenomics is no longer data generation but effective collection, management, analysis, and interpretation of data . This principle extends to ugpA research, where methodological innovations should focus on enhancing data integration and interpretation.

How might experimental design evolve to address complex questions about ugpA regulation?

Advancing understanding of ugpA regulation requires evolved experimental designs:

  • Temporal sampling strategies:

    • High-frequency sampling to capture dynamic responses

    • Long-term evolution experiments to study adaptive regulatory changes

    • Synchronized cell populations for cell-cycle dependent analysis

  • Perturbation approaches:

    • Targeted chemical inhibitors of specific regulatory components

    • Genetic toggle switches for controlled expression

    • Environmental fluctuation experiments to study regulatory dynamics

  • Comparative systems:

    • Cross-species analysis of ugpA regulation

    • Examination of ugpA in different ecological contexts

    • Evolutionary reconstruction of regulatory network development

  • Multi-level experimental design:

    • Nested designs that capture variation at molecular, cellular, and population levels

    • Factorial designs to identify interaction effects between regulatory factors

    • Adaptive designs that modify protocols based on interim results

The design must reflect the question being asked, the limitations of the experimental system, and the methods that will be used to analyze the data . For ugpA regulation, this means designing experiments that can disentangle multiple levels of control while accounting for metabolic context.

What are the critical knowledge gaps in understanding ugpA function?

Despite significant advances, several knowledge gaps remain in ugpA research:

  • Structural dynamics during transport process

  • Interaction specificity with the periplasmic binding protein

  • Regulatory mechanisms beyond phosphate limitation

  • Energy coupling mechanisms for active transport

  • Evolutionary conservation and divergence across bacterial species

Addressing these gaps will require integrated approaches combining structural biology, molecular genetics, and systems biology perspectives.

What standardized protocols would enhance reproducibility in ugpA research?

To enhance reproducibility, the field would benefit from standardization in:

  • Growth conditions for ugp induction

  • Transport activity assay protocols

  • Genetic manipulation approaches

  • Structural characterization methodologies

  • Data reporting requirements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.