Recombinant Sodalis glossinidius 4-hydroxybenzoate octaprenyltransferase (ubiA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiA; SG2143; 4-hydroxybenzoate octaprenyltransferase; 4-HB polyprenyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
ubiA
Target Protein Sequence
MDHSLTQDRWQAWCRLMRIDKPIGSLLLLWPTLWALWLAGMAIPALGTLTVFILGVFFMR AAGCVINDYADRKIDGHVKRTRARPLPSGAIGEKEAKLLFGALVGISFALVLTLNSMTIA LSTVALALAWVYPFMKRYTHLPQLVLGAAFGWSIPMVFTAVSESLPLSCWLLFLANITWT VAYDTQYAMVDRDDDLRIGVKSTAILFGRFDKLIIGLLQLATLLLLGVIGWQLGLGRIYY LALAGAAGLFLWQQKLIVDREREACFRAFLNNNLVGMLIFVGILLSLLSY
Uniprot No.

Target Background

Function
Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. This enzyme mediates the second step in the final reaction sequence of ubiquinone-8 (UQ-8) biosynthesis. This step involves the condensation of the polyisoprenoid side chain with PHB, generating the first membrane-bound Q intermediate 3-octaprenyl-4-hydroxybenzoate.
Database Links

KEGG: sgl:SG2143

STRING: 343509.SG2143

Protein Families
UbiA prenyltransferase family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sodalis glossinidius 4-hydroxybenzoate octaprenyltransferase (ubiA) and what is its biological function?

4-hydroxybenzoate octaprenyltransferase (ubiA) from Sodalis glossinidius is a member of the UbiA superfamily of intramembrane prenyltransferases that catalyzes essential reactions in the biosynthesis of ubiquinone (coenzyme Q) . As part of the electron transport chain, this enzyme transfers a prenyl group to 4-hydroxybenzoate, representing a critical step in ubiquinone biosynthesis. The enzyme is encoded by the ubiA gene (locus name SG2143) in S. glossinidius, a maternally transmitted secondary endosymbiont residing intracellularly in tissues of tsetse flies (Glossina spp.) .

The protein's functional importance stems from its role in generating lipophilic compounds essential for biological membranes. These compounds participate in electron transport processes and function as antioxidants, as well as contributing to the structural integrity of microbial cell walls and membranes .

How is Sodalis glossinidius ubiA phylogenetically related to other bacterial prenyltransferases?

Sodalis glossinidius, including its ubiA gene, shares phylogenetic relationships with members of the Enterobacteriaceae family. While specific phylogenetic data for ubiA isn't detailed in the provided sources, we can infer from related research that S. glossinidius has evolutionary connections to enteric pathogens like Shigella and Salmonella .

Phylogenetic reconstructions based on other genes (inv/spa) have consistently identified a well-supported clade containing Sodalis and these enteric pathogens, suggesting that Sodalis may have evolved from an ancestor with a parasitic intracellular lifestyle . This supports the hypothesis that vertically transmitted mutualistic endosymbionts like Sodalis evolved from horizontally transmitted parasites through a parasitism-mutualism continuum .

Within the UbiA superfamily specifically, member proteins share conserved structural features despite varying significantly in their enzymatic activities and substrate selectivities . The conservation of key functional domains across bacterial, archaeal, and eukaryotic UbiA homologs indicates the fundamental importance of these prenyltransferases throughout evolution.

What are the optimal expression and purification methods for recombinant Sodalis glossinidius ubiA?

Optimal expression and purification of recombinant Sodalis glossinidius ubiA requires specialized protocols for membrane proteins. Based on established methodologies for similar proteins in the UbiA superfamily, the following approach is recommended:

Expression System:

  • E. coli strains optimized for membrane protein expression (C41(DE3) or C43(DE3))

  • Vector containing an inducible promoter (e.g., T7) and suitable affinity tag (His6 or Twin-Strep)

  • Expression at lower temperatures (16-20°C) following induction to facilitate proper folding

Purification Protocol:

  • Cell lysis via sonication or high-pressure homogenization in buffer containing protease inhibitors

  • Membrane fraction isolation through differential centrifugation

  • Solubilization using mild detergents (n-dodecyl-β-D-maltoside or n-octyl-β-D-glucopyranoside)

  • Affinity chromatography using the engineered tag

  • Size exclusion chromatography for final purification and buffer exchange

For functional studies, it's crucial to maintain the protein in an environment that mimics the native membrane, either through detergent micelles or reconstitution into liposomes or nanodiscs . Storage buffer typically contains 50% glycerol and Tris-based buffer optimized for stability, as used for commercial preparations .

What experimental approaches are effective for assessing Sodalis glossinidius ubiA enzymatic activity?

Assessing the enzymatic activity of Sodalis glossinidius ubiA requires methods that can detect the transfer of prenyl groups to 4-hydroxybenzoate. Several complementary approaches are recommended:

Radiometric Assay:

  • Utilizes [14C]-labeled prenyl diphosphate substrates

  • Product formation quantified via scintillation counting after organic extraction

  • Provides high sensitivity and direct quantification of enzymatic activity

HPLC-Based Methods:

  • Separation of substrates and products via reverse-phase HPLC

  • UV detection at wavelengths specific for aromatic products (≈290 nm)

  • Allows for kinetic parameter determination and inhibitor screening

Coupled Enzymatic Assays:

  • Measuring pyrophosphate release during the prenylation reaction

  • Using coupled enzymes that generate a fluorescent or colorimetric readout

  • Enables high-throughput screening applications

For in-depth mechanistic studies, reconstituted systems using purified components can reveal the effects of membrane composition and lipid environment on enzyme activity. When analyzing the results, it's essential to consider the membrane environment's influence on the catalytic properties of this intramembrane prenyltransferase .

What are the recommended methods for studying Sodalis glossinidius ubiA in its native context within the tsetse fly symbiont?

Studying Sodalis glossinidius ubiA in its native context presents unique challenges due to the intracellular symbiotic lifestyle of this bacterium. The following approaches are recommended:

Cell Culture Systems:

  • Insect cell lines (like A. albopictus C6/36) can be used as a controlled environment for studying S. glossinidius

  • Monitor bacterial invasion and intracellular growth via microscopy and staining (e.g., Gimenez staining)

  • Assess the role of ubiA in symbiont fitness during host cell colonization

Genetic Manipulation Strategies:

  • Transposon mutagenesis approaches similar to those used for other S. glossinidius genes

  • Targeted gene disruption using suicide vectors

  • Complementation studies to verify phenotypes

Expression Analysis:

  • RT-qPCR to quantify ubiA expression under different conditions

  • RNA-seq to understand transcriptional context within metabolic networks

  • Proteomics to assess protein production in the native context

For in vivo studies, microinjection of manipulated S. glossinidius into tsetse flies has been demonstrated as an effective approach to study symbiont function . When designing these experiments, consider the life cycle and transmission patterns of the symbiont, as well as the physiological state of the host insect.

How does the function of Sodalis glossinidius ubiA relate to the symbiotic relationship with tsetse flies?

The function of Sodalis glossinidius ubiA in ubiquinone biosynthesis likely plays a critical role in the symbiotic relationship with tsetse flies through several interconnected mechanisms:

Energy Metabolism Support:
Ubiquinone is essential for cellular respiration and ATP generation. As an intracellular symbiont, S. glossinidius needs efficient energy metabolism to maintain its population within host tissues without depleting host resources. The ubiA enzyme supports this metabolic balance by enabling electron transport chain functionality .

Oxidative Stress Management:
Tsetse flies, like other insects, generate significant reactive oxygen species during flight and metabolism. Ubiquinone functions as an antioxidant in membranes, potentially protecting both the symbiont and host tissues from oxidative damage. This protective function may be part of the mutualistic benefit S. glossinidius provides to its host .

Symbiont Persistence Mechanisms:
S. glossinidius utilizes type III secretion systems for initial invasion of host cells . While not directly related to invasion, proper membrane function maintained by ubiA-derived products may support the expression and assembly of these invasion systems, contributing to the symbiont's ability to establish and maintain infection across host generations.

This relationship exemplifies the evolution from parasitism to mutualism, as suggested by phylogenetic evidence showing S. glossinidius shares ancestry with enteric pathogens like Salmonella and Shigella .

What structural features distinguish Sodalis glossinidius ubiA from other UbiA superfamily members and how might this influence its catalytic properties?

While specific structural data for Sodalis glossinidius ubiA is not detailed in the provided sources, analysis of its sequence and comparison with characterized UbiA superfamily members reveals several distinguishing features that likely influence its catalytic properties:

Transmembrane Architecture:
The UbiA superfamily members share a core architecture of multiple transmembrane helices that create a hydrophobic active site within the membrane . S. glossinidius ubiA contains predicted transmembrane domains consistent with this arrangement, but specific variations in these domains may tune substrate specificity.

Aspartate-Rich Motifs:
UbiA superfamily enzymes typically contain conserved aspartate-rich motifs (NDXXD) that coordinate divalent cations necessary for catalysis . Variations in these motifs or their spatial arrangement could influence metal ion binding and thus catalytic efficiency.

Substrate Channel Features:
The amino acid composition of the substrate-binding pocket determines prenyl chain length specificity. The sequence of S. glossinidius ubiA suggests it likely accommodates octaprenyl (C40) diphosphate as a substrate, reflecting adaptation to the specific membrane environment of this intracellular symbiont.

These structural features collectively determine the enzyme's ability to function within the specific membrane environment of an intracellular symbiont. Further crystallographic studies, similar to those performed with archaeal homologs, would be valuable for elucidating the specific structural adaptations of S. glossinidius ubiA .

What strategies can be employed to develop inhibitors specific to Sodalis glossinidius ubiA without affecting host enzymes?

Developing inhibitors specific to Sodalis glossinidius ubiA without cross-reactivity with host enzymes requires exploiting structural and biochemical differences between bacterial and eukaryotic prenyltransferases. The following strategies offer promising approaches:

Structure-Based Design:

  • Target binding pockets that differ between bacterial and eukaryotic UbiA enzymes

  • Focus on regions outside the highly conserved catalytic site

  • Utilize molecular docking and dynamics simulations to identify selective binding modes

Substrate Analog Approach:

  • Design compounds that mimic the transition state of the prenylation reaction

  • Incorporate features that exploit differences in substrate channel dimensions

  • Develop prenyl diphosphate analogs with modifications that are tolerated by bacterial but not host enzymes

Allosteric Inhibition Strategy:

  • Identify allosteric sites specific to bacterial UbiA enzymes

  • Design modulators that bind these sites to induce conformational changes

  • Focus on regulatory mechanisms that may differ between bacterial and eukaryotic enzymes

Testing Methodology:

  • Initial screening using recombinant enzymes

  • Secondary verification in bacterial cultures

  • Selectivity assessment against insect and mammalian cell lines

  • Evaluation in ex vivo systems with isolated tsetse tissues

This approach could lead to selective agents for studying symbiotic relationships or potentially therapeutic interventions for tsetse-transmitted diseases by disrupting the symbiont without harming the host or associated beneficial microbes.

What are the common challenges in expressing and purifying functional Sodalis glossinidius ubiA and how can they be addressed?

Expressing and purifying functional Sodalis glossinidius ubiA presents several challenges typical of membrane-bound prenyltransferases. The following table outlines common issues and recommended solutions:

ChallengeDescriptionSolution Strategy
Low expression levelsMembrane proteins often express poorly in heterologous systemsUse specialized strains (C41/C43), lower induction temperature (16-20°C), optimize codon usage for expression host
Protein misfoldingImproper insertion into membranes leads to aggregationInclude molecular chaperones as co-expression partners, use milder induction conditions
Extraction efficiencyDifficulty in solubilizing from membranesScreen detergent panel (DDM, LMNG, GDN) at various concentrations, try detergent mixtures
Protein instabilityLoss of activity during purificationInclude stabilizing ligands during purification, maintain cold temperatures throughout process
Aggregation during concentrationTendency to aggregate at higher concentrationsAdd glycerol (10-20%), limit concentration steps, use spin filters with larger MWCO
Activity lossDiminished enzymatic function after purificationReconstitute into liposomes or nanodiscs to restore native-like membrane environment

When troubleshooting activity issues, consider that UbiA superfamily enzymes require specific lipid environments and divalent cations (typically Mg²⁺) for optimal function . Including these components in activity assays is essential for accurate assessment of enzymatic properties.

How can researchers effectively design experiments to study the role of Sodalis glossinidius ubiA in host-symbiont interactions?

Designing experiments to elucidate the role of Sodalis glossinidius ubiA in host-symbiont interactions requires multidisciplinary approaches spanning molecular biology, biochemistry, and insect physiology:

Genetic Manipulation Approach:

  • Generate ubiA knockout mutants using transposon mutagenesis or targeted gene disruption

  • Create complementation strains with controlled expression

  • Develop point mutations targeting key catalytic residues for structure-function studies

  • Introduce these strains into insect cell culture systems and intact tsetse flies

Phenotypic Analysis Framework:

  • Assess bacterial invasion and persistence in host cells using microscopy techniques

  • Measure bacterial loads in different tissues over time

  • Evaluate host fitness parameters (survival, reproduction, development)

  • Monitor metabolite profiles in both symbiont and host

Temporal Considerations:
The timeline for host-symbiont interaction experiments should accommodate the slow growth of S. glossinidius (visible intracellular bacteria appear after 8 hours, with significant replication by 24 hours) . Long-term studies (>96 hours) may be necessary to observe effects on host physiology.

Controls and Variables:

  • Include wild-type S. glossinidius strains as positive controls

  • Use non-invasive mutant strains as additional controls

  • Account for variability in host genetic background

  • Control environmental factors (temperature, humidity, nutrition) that affect symbiont dynamics

This experimental framework allows for comprehensive assessment of how ubiA function contributes to the establishment and maintenance of the symbiotic relationship with tsetse flies.

What analytical techniques best resolve the enzymatic products of Sodalis glossinidius ubiA and how should data be interpreted?

Resolving and interpreting the enzymatic products of Sodalis glossinidius ubiA requires sophisticated analytical techniques suited to prenylated compounds:

LC-MS/MS Analysis:

  • Ultra-high performance liquid chromatography coupled with tandem mass spectrometry

  • Multiple reaction monitoring for specific product identification

  • Quantification using isotopically labeled internal standards

  • Resolution of prenyl chain length variations (C30-C50)

Interpretation Guidelines:

  • Establish standard curves with authentic prenylated standards

  • Account for extraction efficiency variations between samples

  • Consider the influence of detergents on chromatographic behavior

  • Validate identifications with multiple mass transitions and retention time matching

Data Analysis Workflow:

  • Raw data processing with appropriate baseline correction

  • Peak integration and normalization to internal standards

  • Statistical analysis comparing experimental conditions

  • Kinetic parameter calculation for mechanistic studies

Complementary Techniques:

  • NMR spectroscopy for structural confirmation of isolated products

  • UV-visible spectroscopy for tracking reaction progress

  • Native mass spectrometry for enzyme-substrate complex analysis

When interpreting results, researchers should consider the membrane environment's influence on enzyme activity, as UbiA superfamily members show significant dependence on membrane composition and physical properties . Variations in these parameters may explain differences observed between in vitro and in vivo studies.

What emerging technologies could advance our understanding of Sodalis glossinidius ubiA structure-function relationships?

Several cutting-edge technologies offer promising avenues for deeper investigation of Sodalis glossinidius ubiA structure-function relationships:

Cryo-Electron Microscopy:

  • Single-particle analysis for high-resolution structural determination

  • Visualization of conformational states during catalysis

  • Structure determination without crystallization, overcoming challenges inherent to membrane proteins

  • Potential to capture enzyme-substrate complexes in near-native conditions

Integrative Structural Biology Approaches:

  • Combining X-ray crystallography, NMR, and computational modeling

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions

  • Cross-linking mass spectrometry to identify interacting domains

  • Small-angle X-ray scattering to analyze conformational ensembles

Advanced Microscopy for In Situ Studies:

  • Super-resolution microscopy to visualize UbiA localization within bacterial membranes

  • Correlative light and electron microscopy to connect function with ultrastructure

  • Live-cell imaging with activity-based probes to track enzyme dynamics

Computational Methods:

  • Molecular dynamics simulations in explicit membrane environments

  • Quantum mechanics/molecular mechanics approaches for reaction mechanism studies

  • Machine learning algorithms for predicting structure-function relationships across UbiA homologs

These technologies, when applied in combination, will provide unprecedented insights into how the structural features of S. glossinidius ubiA enable its specialized function within the symbiotic context of tsetse fly association .

How might systems biology approaches contribute to understanding the metabolic integration of ubiA function in Sodalis glossinidius?

Systems biology approaches offer powerful frameworks for contextualizing ubiA function within the broader metabolic network of Sodalis glossinidius and its host interaction:

Multi-omics Integration:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Map temporal changes during host colonization and symbiont establishment

  • Identify regulatory networks controlling ubiA expression

  • Connect ubiquinone biosynthesis with other metabolic pathways

Flux Analysis Applications:

  • Use isotope labeling to track carbon flow through prenylation pathways

  • Measure metabolic flux changes under different physiological conditions

  • Identify metabolic bottlenecks in ubiquinone biosynthesis

  • Assess how host-derived metabolites influence symbiont metabolism

Predictive Modeling:

  • Develop constraint-based models of S. glossinidius metabolism

  • Simulate the effects of ubiA perturbation on system-wide function

  • Integrate host-symbiont metabolic models

  • Predict intervention points for manipulating symbiotic relationships

Ecological Network Perspectives:

  • Extend analysis to include tsetse microbiome interactions

  • Study competitive or cooperative relationships between different symbionts

  • Investigate host immune system interactions with symbiont metabolism

  • Model evolutionary trajectories from parasitism to mutualism

What are the potential applications of Sodalis glossinidius ubiA research in developing strategies for vector-borne disease control?

Research on Sodalis glossinidius ubiA offers several promising avenues for vector-borne disease control strategies, particularly for African trypanosomiasis transmitted by tsetse flies:

Paratransgenic Approach:

  • Engineer S. glossinidius to express anti-trypanosome effector molecules

  • Use ubiA promoter regions for conditional expression systems

  • Develop ubiA-based selectable markers for genetic manipulation

  • Create modified S. glossinidius strains with enhanced vertical transmission

Symbiont Replacement Strategy:

  • Design modified S. glossinidius with altered ubiA activity

  • Introduce symbionts that outcompete natural populations

  • Create fitness advantages for modified symbionts through metabolic engineering

  • Reduce vector capacity while maintaining insect fitness

Targeted Inhibitor Development:

  • Design selective inhibitors of S. glossinidius ubiA

  • Disrupt symbiont metabolism without harming beneficial microbiota

  • Develop delivery methods for inhibitors (e.g., baited sugar feeds)

  • Create formulations that enhance uptake into the insect hemolymph

Risk Assessment Framework:

  • Evaluate ecological impacts of manipulating symbiont populations

  • Assess potential for horizontal gene transfer

  • Monitor resistance development

  • Measure effects on non-target organisms

This research has significant potential due to the critical role of S. glossinidius in tsetse fly biology and the evolutionary relationship between this symbiont and pathogenic bacteria . By targeting the ubiA enzyme specifically, it may be possible to develop precise interventions that disrupt disease transmission while minimizing environmental impacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.