Recombinant Sodalis glossinidius ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

ATP Synthase and Subunit b (atpF)

ATP synthase (F1F0-ATPase) is a protein complex that produces adenosine triphosphate (ATP), the primary energy currency of cells. It utilizes a proton gradient across a membrane to drive the synthesis of ATP from adenosine diphosphate (ADP) and inorganic phosphate . The enzyme consists of two main components: the F0 portion, which is embedded in the membrane and facilitates proton translocation, and the F1 portion, which is located in the cytoplasm or matrix and catalyzes ATP synthesis .

The subunit b (atpF) is a crucial component of the F0 complex. While its exact function can vary slightly among different organisms, it generally plays a structural role in connecting the F1 and F0 complexes, and is involved in proton translocation .

Sodalis glossinidius

Sodalis glossinidius is a Gram-negative, facultative symbiotic bacterium belonging to the family Enterobacteriaceae. It is found in the tsetse fly (Glossina species) and is transmitted vertically from mother to offspring. Sodalis is considered a secondary symbiont, coexisting with the primary symbiont Wigglesworthia glossinidia . Sodalis has a smaller genome compared to free-living bacteria, but it retains genes for various metabolic pathways, including amino acid biosynthesis and the tricarboxylic acid cycle .

Recombinant Production of atpF

Recombinant DNA technology allows for the production of specific proteins in large quantities for research purposes. The gene encoding the Sodalis glossinidius ATP synthase subunit b (atpF) can be cloned and expressed in a suitable host organism such as E. coli . The resulting recombinant protein can then be purified and used for structural and functional studies.

Research Findings and Significance

Research on recombinant Sodalis glossinidius ATP synthase subunit b (atpF) can provide insights into:

  1. Structural Properties: Studies on a polypeptide modeled on the soluble portion of the b subunit (bsol) have been used to investigate dimerization of the b subunit . Introducing amino acid substitutions into bsol at the position comparable to ala-79 of the b subunit using site-directed mutagenesis can affect dimerization .

    McCormick et al. (J. Biol. Chem. 1993. 268:24683-24691) observed that mutations at ala-79 of the b subunit affect assembly of F1F0 ATP synthase .

  2. Functional Roles: Understanding the role of atpF in the ATP synthase complex of Sodalis glossinidius can help elucidate the bioenergetics of this symbiotic bacterium.

  3. Drug Target Potential: ATP synthase is a validated drug target in bacteria, including mycobacteria . Inhibitors targeting specific subunits, including subunit b, can disrupt ATP production and bacterial viability .

  4. Symbiotic Interactions: Investigating the ATP synthase of Sodalis glossinidius can provide insights into the symbiotic relationship between the bacterium and the tsetse fly.

  5. Metabolic pathways: Sodalisvia array hybridization can allow detection of a complete set of genes involved in many metabolic pathways such as those associated with amino acid biosynthesis (e.g., trpABCDEfor tryptophan, hisABCDFGHIfor histidine, and thrABC, metL, lysC, and asdfor threonine biosynthesis) and the tricarboxylic acid cycle (sdhABCD, sucABCD, fumABC, acnAB, gltA, icdA, and mdh) .

Future Directions

Future research on recombinant Sodalis glossinidius ATP synthase subunit b (atpF) could focus on:

  • Determining the crystal structure of the atpF subunit or the entire ATP synthase complex.

  • Investigating the interaction of atpF with other subunits and regulatory proteins.

  • Screening for inhibitors that specifically target the Sodalis glossinidius ATP synthase.

  • Studying the impact of ATP synthase dysfunction on the symbiosis between Sodalis and the tsetse fly.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; SG2410; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVLFCMKYVWPPLMASIEKRQKEIADGLASAERAKKDLDIAQAE ATDHLKQAKVEAQAIIEQANKRKAQVVDEAKAEAEAERNKILAQAQAEIDAERKRAREEL RKQVAMLALAGAEKIIERSVDDAANSDIVDKIVAEL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This subunit is a component of the F(0) channel, forming part of the peripheral stalk that links F(1) and F(0).
Database Links

KEGG: sgl:SG2410

STRING: 343509.SG2410

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the significance of studying Sodalis glossinidius ATP synthase subunit b in symbiotic research?

ATP synthase subunit b (atpF) is a critical component of bacterial energy metabolism, particularly in symbiotic relationships where nutritional and energy dependencies exist between host and symbiont. S. glossinidius maintains a unique facultative intracellular lifestyle in tsetse flies, making it an excellent model organism for studying symbiotic adaptations . The study of atpF can provide insights into how energy generation mechanisms have adapted to support the symbiotic lifestyle. Furthermore, understanding the regulation and expression of metabolic genes like atpF helps elucidate how S. glossinidius responds to different environmental conditions within its host, particularly during events like trypanosome infection attempts .

Similar to other S. glossinidius genes studied in transcriptomic analyses, atpF expression may vary depending on the physiological state of the host or during exposure to stressors, such as when the tsetse fly encounters trypanosomes . Research has shown that metabolic and biosynthetic processes in S. glossinidius are differentially regulated during different host conditions, suggesting that energy metabolism genes like atpF are likely key players in adaptation to the symbiotic lifestyle .

What are the basic experimental design considerations when studying recombinant Sodalis glossinidius atpF?

When designing experiments to study recombinant S. glossinidius atpF, researchers should follow a structured approach to ensure valid and reproducible results:

Experimental Design ComponentConsiderations for atpF Research
Independent VariablesGrowth media composition, iron/nutrient availability, host presence, trypanosome exposure
Dependent VariablesatpF expression level, ATP production, protein-protein interactions
Control GroupsWild-type S. glossinidius, other ATP synthase subunit mutants, non-symbiotic bacteria
Measurement MethodsqPCR, GFP-fusion reporters, enzymatic assays, proteomics
Typical Sample Size3-5 biological replicates, 2-3 technical replicates per condition

How can I effectively express and purify recombinant Sodalis glossinidius atpF protein?

Expressing and purifying recombinant S. glossinidius atpF requires careful optimization of expression systems and purification protocols. Based on successful approaches with other S. glossinidius proteins, the following methodological steps are recommended:

  • Expression system selection: While E. coli is commonly used for heterologous expression of bacterial proteins, careful consideration of codon optimization is necessary for S. glossinidius genes. E. coli has been successfully used as a surrogate host for functional studies of S. glossinidius genes, including promoter-GFP fusions .

  • Vector design: Include appropriate tags (His, GST, or MBP) for purification and detection. For membrane proteins like atpF, consider using solubility-enhancing fusion tags.

  • Expression conditions: Optimize temperature, induction time, and inducer concentration. Lower temperatures (16-20°C) often improve the solubility of recombinant membrane proteins.

  • Cell lysis and membrane protein extraction: Use gentle detergents suitable for membrane proteins (e.g., n-dodecyl β-D-maltoside or CHAPS) to solubilize atpF while maintaining its native conformation.

  • Purification strategy: Implement a multi-step purification approach using affinity chromatography followed by size-exclusion chromatography to achieve high purity.

  • Functional validation: Assess the activity and structural integrity of the purified protein through ATPase activity assays and structural analysis techniques.

When working with S. glossinidius proteins, researchers should be aware that this bacterium has evolved in a host-restricted environment, potentially affecting the expression and folding of its proteins in heterologous systems. Similar considerations have been documented for other S. glossinidius proteins studied in recombinant systems .

How does the expression of Sodalis glossinidius atpF change during trypanosome infection in tsetse flies?

The expression of metabolic genes in S. glossinidius has been shown to change significantly in response to trypanosome exposure in tsetse flies, even when flies ultimately resist infection. While the specific regulation of atpF has not been directly reported in the provided literature, the pattern observed for other metabolic genes provides insights into potential atpF regulation.

Microarray studies comparing S. glossinidius gene expression in trypanosome-refractory flies versus control flies have identified 17 significantly differentially expressed genes, all of which were overexpressed in self-cured (refractory) flies . Many of these genes are involved in metabolic and biosynthetic processes as well as oxidation-reduction mechanisms. For example, the oxidative respiration complex enzyme NADH dehydrogenase (SG1597) was found to be 1.4-fold overexpressed in refractory flies .

Given that ATP synthase and NADH dehydrogenase are both components of oxidative phosphorylation, it is plausible that atpF expression might also be upregulated during trypanosome challenge, particularly in flies that successfully clear the infection. This would align with the apparent increased energy demands during immune responses.

To study atpF expression specifically during trypanosome infection, researchers should:

  • Design qPCR primers specific to S. glossinidius atpF

  • Compare expression in flies fed with trypanosome-infected versus non-infected blood meals

  • Track expression changes over time following exposure

  • Consider subpopulations of flies (susceptible versus refractory)

  • Correlate atpF expression with other energy metabolism genes

What role might the PhoP-PhoQ regulatory system play in controlling Sodalis glossinidius atpF expression?

The PhoP-PhoQ two-component regulatory system in S. glossinidius has been identified as a master regulator that controls the expression of multiple genes involved in critical symbiotic functions . While direct regulation of atpF by PhoP-PhoQ has not been explicitly demonstrated in the provided literature, there are compelling reasons to investigate this relationship.

The PhoP-PhoQ system in S. glossinidius has undergone functional adaptations resulting in a diminished ability to sense ancestral signals, allowing constitutive expression of genes that facilitate resistance to host-derived antimicrobial peptides (AMPs) . This adaptation represents a novel response to the static symbiotic lifestyle. Since energy metabolism is critical for survival in the symbiotic state, the regulation of ATP synthase components like atpF could potentially fall under PhoP-PhoQ control.

To investigate this potential regulatory relationship, researchers could:

  • Compare atpF expression in wild-type versus phoP mutant strains: Create a phoP knockout in S. glossinidius using intron mutagenesis (similar to methods reported in the literature) and measure atpF expression using qRT-PCR.

  • Analyze the atpF promoter region: Search for PhoP binding motifs in the promoter region of atpF using bioinformatic approaches and validate through electrophoretic mobility shift assays.

  • Construct atpF promoter-GFP fusions: Similar to approaches used for other S. glossinidius genes, create promoter-GFP fusions to monitor atpF expression in different genetic backgrounds (wild-type vs. ΔphoP) .

  • Perform chromatin immunoprecipitation (ChIP) assays: Use ChIP to directly test whether PhoP binds to the atpF promoter in vivo.

If atpF is indeed regulated by PhoP-PhoQ, this would suggest that energy metabolism in S. glossinidius is coordinated with host defense mechanisms, potentially as part of a broader adaptive response to the symbiotic lifestyle.

How can iron limitation affect the expression and function of recombinant Sodalis glossinidius atpF?

Iron availability is a critical factor affecting bacterial gene expression, particularly in host-symbiont interactions. Research has shown that S. glossinidius possesses iron acquisition systems that are regulated in response to iron availability through the Fur (ferric uptake regulator) system . Although the direct effect of iron on atpF expression hasn't been specifically documented in the provided literature, several lines of evidence suggest potential relationships.

Iron limitation often triggers metabolic reprogramming in bacteria, affecting energy generation pathways including ATP synthesis. In S. glossinidius, genes involved in iron acquisition like hemT (periplasmic heme transporter) and sitA (iron/manganese transporter) show increased expression under iron-limiting conditions . This regulation is mediated by the Fur transcriptional repressor, which acts as an iron-responsive regulator.

To investigate how iron affects recombinant S. glossinidius atpF expression and function, researchers should:

  • Assess atpF expression under varying iron concentrations: Culture S. glossinidius in media with different iron concentrations and measure atpF transcript levels using qRT-PCR.

  • Analyze atpF promoter activity: Create atpF promoter-GFP fusions (similar to those created for hemT and sitA) and monitor fluorescence in iron-replete versus iron-deplete conditions.

  • Examine atpF expression in a fur mutant: Construct a fur deletion mutant using intron mutagenesis and compare atpF expression to wild-type under various iron conditions.

  • Measure ATP synthase activity: Purify recombinant atpF protein expressed under different iron conditions and assess its ability to function properly in ATP synthase complex assembly and activity.

Iron ConditionExpected Gene Expression PatternExperimental Approach
Iron LimitationPotential upregulation of atpF if regulated by FurGrowth in chelated media; qRT-PCR; promoter-GFP fusion
Iron RepletionPotential downregulation if Fur-regulatedGrowth in iron-supplemented media; qRT-PCR; promoter-GFP fusion
In Tsetse FlyContext-dependent expressionRNA extraction from flies; in vivo GFP reporter analysis

What structural and functional differences exist between Sodalis glossinidius atpF and its homologues in free-living bacteria?

As a symbiotic bacterium, S. glossinidius has undergone genomic streamlining and adaptation to its host environment, potentially affecting the structure and function of essential proteins like ATP synthase subunit b (atpF). While the provided literature doesn't directly compare atpF across different bacterial species, insights can be drawn from observed patterns in other S. glossinidius proteins.

S. glossinidius has been shown to undergo a process of degenerative evolution that streamlines its gene inventory in accordance with the obligate nature of the host-associated lifestyle . This evolutionary trajectory has led to functional adaptations in regulatory systems like PhoP-PhoQ, which has lost some sensory capabilities compared to homologues in free-living bacteria .

For atpF, researchers should investigate:

  • Sequence conservation analysis: Compare S. glossinidius atpF sequences with homologues from free-living relatives like E. coli to identify conserved domains and symbiont-specific variations.

  • Structural modeling: Use computational approaches to predict structural differences that might affect ATP synthase assembly or function.

  • Functional complementation: Test whether S. glossinidius atpF can functionally replace its homologues in free-living bacteria through genetic complementation studies.

  • Biochemical characterization: Compare enzymatic properties (optimal pH, temperature, substrate affinity) of recombinant atpF from S. glossinidius versus free-living bacteria.

  • Protein-protein interaction analysis: Investigate whether S. glossinidius atpF has altered interaction capabilities with other ATP synthase subunits compared to free-living bacterial homologues.

These comparisons would reveal whether atpF has undergone adaptive evolution in S. glossinidius and provide insights into how energy metabolism has been shaped by the symbiotic lifestyle.

How can recombinant Sodalis glossinidius atpF be used as a tool to study tsetse fly-trypanosome interactions?

Recombinant S. glossinidius atpF can serve as a valuable tool for understanding the complex tripartite relationship between tsetse flies, S. glossinidius, and trypanosomes. Research has established that S. glossinidius influences trypanosome infection in tsetse flies, with only a small percentage of flies becoming infected after exposure .

As a component of energy metabolism, atpF could play a role in the symbiont's ability to either support or hinder trypanosome establishment. Researchers can leverage recombinant atpF in several ways:

  • Develop atpF mutant strains: Create S. glossinidius strains with modified atpF expression or function to assess how changes in symbiont energy metabolism affect trypanosome establishment in the fly.

  • Use atpF as a reporter: Create atpF-reporter fusions to monitor S. glossinidius metabolic activity in different host tissues during trypanosome infection attempts.

  • Create atpF-based interaction assays: Develop biochemical assays using recombinant atpF to screen for trypanosome factors that might interact with or affect symbiont energy metabolism.

  • Investigate metabolic crosstalk: Study whether trypanosome presence alters atpF expression as part of the "molecular crosstalk between the different partners" that has been observed even when parasites fail to establish permanent infection .

  • Develop targeted interventions: Based on atpF functional studies, design approaches to modify symbiont energy metabolism in ways that might enhance tsetse refractoriness to trypanosome infection.

This research direction is particularly promising given the evidence that trypanosome challenge leads to differential gene expression in S. glossinidius, even in flies that successfully clear the infection .

What are the most important considerations when interpreting results from recombinant Sodalis glossinidius atpF studies?

  • Context of expression system: Results from heterologous expression systems may not perfectly reflect the protein's behavior in its native symbiotic context. S. glossinidius proteins may have adapted to function optimally within the specific environment of the tsetse fly host .

  • Regulatory network integration: atpF functions as part of the larger ATP synthase complex and may be regulated in concert with other metabolic genes. Expression patterns observed in isolation should be interpreted within the broader context of energy metabolism regulation .

  • Host-symbiont interactions: S. glossinidius gene expression is influenced by the physiological state of the tsetse fly host. Variations in host factors could impact experimental reproducibility and interpretation .

  • Evolutionary context: As a symbiotic bacterium, S. glossinidius is undergoing genome reduction and adaptation to host environments. Functional differences compared to homologous proteins in free-living bacteria may reflect evolutionary adaptations rather than experimental artifacts .

  • Methodological limitations: Different techniques for measuring gene expression or protein function have inherent limitations. For example, microarray technology (used in some S. glossinidius studies) may not capture the full dynamic range of expression changes compared to RNA-seq .

What future research directions are most promising for understanding the role of ATP synthase in Sodalis glossinidius symbiosis?

Based on current knowledge of S. glossinidius biology and gaps in understanding, several promising research directions emerge for investigating ATP synthase's role in this symbiotic relationship:

  • Systems biology approach: Integrate transcriptomic, proteomic, and metabolomic data to understand how ATP synthase functions within the broader metabolic network of S. glossinidius during different host states.

  • In vivo imaging: Develop methods to visualize ATP production and energy dynamics within S. glossinidius while in the tsetse fly host, potentially using genetically encoded ATP sensors.

  • Comparative genomics: Expand analysis of ATP synthase components across multiple symbiont lineages to identify convergent adaptations in energy metabolism genes among insect symbionts.

  • Host-symbiont metabolic integration: Investigate how S. glossinidius ATP production is coordinated with host metabolism and how this coordination might be disrupted during trypanosome challenge.

  • Targeted mutagenesis: Use CRISPR or other precise gene editing techniques to create specific modifications in atpF and other ATP synthase components to elucidate structure-function relationships.

  • Application to vector control: Explore whether manipulating symbiont energy metabolism through ATP synthase modifications could enhance tsetse fly refractoriness to trypanosome infection, potentially contributing to sleeping sickness control strategies.

These directions would build upon the established knowledge that S. glossinidius influences trypanosome infection in tsetse flies and that symbiont gene expression changes in response to parasite challenge , while addressing fundamental questions about the metabolic basis of this important symbiotic relationship.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.