Recombinant Sodalis glossinidius Cardiolipin synthase (cls)

What is Sodalis glossinidius Cardiolipin synthase and what is its functional role?

Cardiolipin synthase (CLS) from Sodalis glossinidius is an enzyme belonging to the CDP-alcohol phosphotransferase family that catalyzes the synthesis of cardiolipin (CL), an essential phospholipid found primarily in mitochondrial membranes. CLS specifically catalyzes the condensation of phosphatidylglycerol (PG) with CDP-diacylglycerol to form cardiolipin . This enzyme plays a critical role in maintaining proper membrane structure and function, particularly in energy-transducing membranes. In bacterial systems like S. glossinidius, cardiolipin is an important component of the cell membrane that affects numerous cellular processes including respiration, osmotic stress response, and cell division.

What is the structural composition of recombinant Sodalis glossinidius Cardiolipin synthase?

The recombinant form of Sodalis glossinidius Cardiolipin synthase is a full-length protein comprising 486 amino acids (1-486aa) . When expressed recombinantly, it is typically fused to an N-terminal His-tag to facilitate purification and detection . The amino acid sequence begins with MTTLYTVINWLLLFGYWLLIAGVTLRVMMKRR as part of its N-terminal region . Similar to other Cardiolipin synthases, it contains the conserved CDP-alcohol phosphotransferase (CDP-OH-P) motif, which is essential for its catalytic activity in binding CDP-diacylglycerol . This motif typically contains conserved residues including D(X)2DG(X)2AR(X)8-9G(X)3D(X)3D that are critical for substrate binding and catalysis.

How does S. glossinidius CLS differ from other bacterial Cardiolipin synthases?

While the search results don't provide specific information about S. glossinidius CLS compared to other bacterial species, comparative analysis of CLS enzymes reveals distinct patterns of conservation. For instance, cardiolipin synthases generally share the core CDP-OH-P motif but differ in regions that likely determine substrate specificity . Unlike phosphatidylglycerophosphate synthases (PGPS), which are functionally distinct despite sequence similarity, CLS enzymes lack certain conserved motifs such as the FxxAxxT sequence that precedes the core CDP-OH-P motif in PGPS enzymes . These differences likely contribute to the functional specificity of CLS enzymes across different species. Based on studies of CLS in other organisms, S. glossinidius CLS likely exhibits species-specific adaptations related to its symbiotic lifestyle within the tsetse fly.

What expression systems are optimal for producing functional recombinant S. glossinidius CLS?

Based on the available information, E. coli has been successfully used as an expression system for producing recombinant S. glossinidius Cardiolipin synthase . This bacterial expression system is advantageous for producing prokaryotic proteins like S. glossinidius CLS because it provides a similar cellular environment, appropriate codon usage, and well-established protocols for high-yield expression.

For optimal expression, researchers should consider the following methodological approaches:

• Vector selection: pET vectors with T7 promoter systems offer strong inducible expression

• E. coli strain selection: BL21(DE3) or Rosetta strains are commonly used for membrane proteins

• Expression conditions: Lower temperatures (16-25°C) and reduced IPTG concentrations often improve the solubility of membrane-associated enzymes

• Inclusion of appropriate detergents during cell lysis and purification to maintain protein stability and activity

What purification strategies yield the highest purity and activity for recombinant S. glossinidius CLS?

The recombinant S. glossinidius CLS is expressed with an N-terminal His-tag, which enables purification using immobilized metal affinity chromatography (IMAC) . For optimal purification results, researchers should consider:

• Initial capture using Ni-NTA or Co2+-based affinity resins

• Inclusion of appropriate detergents (such as DDM, LDAO, or Triton X-100) in purification buffers to maintain protein solubility

• Stepwise imidazole gradient elution to improve purity

• Secondary purification steps such as ion exchange chromatography or size exclusion chromatography

• Buffer optimization to maintain enzyme stability and activity

An effective purification protocol might include the following steps:

• Cell lysis in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 0.5% detergent, and protease inhibitors

• IMAC purification with washing steps using 20-40 mM imidazole

• Elution with 250-300 mM imidazole

• Buffer exchange to remove imidazole and concentrate the protein

What enzymatic assays can be used to measure S. glossinidius CLS activity?

While specific assays for S. glossinidius CLS are not directly mentioned in the search results, we can draw from methodologies used for other CLS enzymes. Based on studies with CrCLS1, several approaches can be adapted:

• Radiolabeling assay: This technique involves incubating the enzyme with radiolabeled substrates (typically 14C or 32P-labeled CDP-diacylglycerol and phosphatidylglycerol) and analyzing the formation of radiolabeled cardiolipin by thin-layer chromatography (TLC) . The radiolabeled cardiolipin spot that co-migrates with commercial CL standards can be quantified to determine enzyme activity.

• Mass spectrometry-based assays: LC-MS/MS can be used to detect and quantify cardiolipin formation without the need for radiolabeled substrates.

• Complementation assays: Functional activity can be assessed through complementation of CLS-deficient mutants (such as the Δcrd1 yeast mutant) by measuring growth restoration at restrictive conditions (e.g., elevated temperature) .

• Phospholipid composition analysis: Changes in phospholipid profiles before and after enzyme addition can be analyzed by techniques such as TLC or HPLC .

How can researchers assess the substrate specificity of S. glossinidius CLS?

To investigate substrate specificity of S. glossinidius CLS, researchers can employ several methodological approaches:

• In vitro enzymatic assays with various substrate analogs:

  • Testing different CDP-diacylglycerol species with varying fatty acid compositions

  • Testing phosphatidylglycerol variants with different acyl chains

  • Evaluating activity with other phospholipid substrates to determine specificity

• Site-directed mutagenesis studies targeting:

  • Conserved residues in the CDP-OH-P motif

  • Residues that differ between CLS and PGPS enzymes, particularly those identified in Figure 7 of the reference

  • Regions predicted to be involved in substrate binding

• Structural studies:

  • Homology modeling based on related CDP-alcohol phosphotransferases

  • Docking studies with different substrates

  • Crystallographic analysis if possible

What are the optimal reaction conditions for S. glossinidius CLS activity?

While specific optimal conditions for S. glossinidius CLS are not provided in the search results, typical conditions for CLS enzymes can be used as a starting point for optimization:

Researchers should systematically vary these parameters to determine the specific optimal conditions for S. glossinidius CLS activity.

How can structural analysis inform the functional mechanism of S. glossinidius CLS?

Advanced structural analysis of S. glossinidius CLS can provide critical insights into its catalytic mechanism and substrate specificity. Based on information from related CLS enzymes, researchers should consider:

• Sequence comparison of the CDP-OH-P motif between CLS and PGPS enzymes to identify potential determinants of substrate specificity. As noted in the search results, while the eight amino acid residues of the core CDP-OH-P motif (D(X)2DG(X)2AR(X)8-9G(X)3D(X)3D) are conserved between PGPS and CLS, seven amino acids (FxxAxxT) immediately before this motif are conserved among PGPSs but not CLSs . Additionally, four other amino acid residues are conserved among PGPS but not in CLS .

• Homology modeling based on the available crystal structure of CDP-alcohol phosphotransferase family members . The structural basis for catalysis in this family was revealed by crystallographic analysis (Sciara et al., 2014) , showing that conserved residues in the CDP-OH-P motif interact with CDP-DAG.

• Mutation studies targeting specific residues that differ between CLS and PGPS to evaluate their role in determining substrate specificity .

• Structure-function studies to determine how the protein recognizes its specific substrates (CDP-DAG and PG for CLS; CDP-DAG and glycerol-3-phosphate for PGPS) .

What physiological roles might S. glossinidius CLS play in host-symbiont interactions?

Sodalis glossinidius is a facultative endosymbiont of tsetse flies, and its CLS likely plays important roles in this symbiotic relationship. Though the search results don't directly address this aspect for S. glossinidius, insights can be drawn from studies of CLS in other organisms:

• Membrane adaptation: CLS activity might be crucial for modifying membrane composition in response to the unique environment inside the tsetse fly host.

• Stress response: In other organisms, CLS expression is regulated in response to environmental stresses. For example, CrCLS1 is down-regulated in response to iron and nitrogen deprivation but up-regulated under copper deficiency and singlet oxygen stress . Similarly, S. glossinidius CLS might be regulated in response to stresses encountered within the host.

• Metabolic integration: Cardiolipin synthesis may be integrated with host-derived nutrients and metabolic pathways, potentially involving shared or complementary lipid metabolism between symbiont and host.

• Cell division and growth: Cardiolipin is important for bacterial cell division processes, which might be synchronized with host developmental stages in this symbiotic relationship.

Research approaches to investigate these aspects could include:

• Transcriptomic analysis of S. glossinidius CLS expression under different host conditions

• Lipidomic analysis of S. glossinidius membrane composition in different host tissues

• Genetic manipulation of CLS expression and monitoring effects on symbiont fitness and host interactions

How might S. glossinidius CLS be used as a model system for understanding CDP-alcohol phosphotransferase evolution?

S. glossinidius CLS represents an interesting model for studying enzyme evolution, particularly within the CDP-alcohol phosphotransferase family. Research approaches could include:

• Comparative genomics: Analyzing CLS sequence conservation across bacterial lineages, with particular focus on free-living versus symbiotic bacteria to identify potential adaptations related to lifestyle.

• Evolutionary trajectory analysis: Examining whether S. glossinidius CLS shows evidence of selection pressures related to its symbiotic lifestyle.

• Functional divergence studies: Comparing substrate specificity and catalytic efficiency between S. glossinidius CLS and related enzymes from both closely and distantly related species.

• Reciprocal complementation studies: Similar to those performed with CrCLS1 , testing whether S. glossinidius CLS can complement defects in other organisms' CLS mutants but not PGPS mutants, to assess functional conservation and specificity.

• Identification of novel motifs: Beyond the core CDP-OH-P motif, identifying additional sequence elements that might define functional specialization, similar to the additional conserved residues noted in the comparison between CLS and PGPS enzymes .

What are common challenges in expressing and purifying functional S. glossinidius CLS and how can they be addressed?

Based on knowledge of membrane-associated enzymes like CLS, researchers might encounter several challenges:

How can researchers overcome substrate availability limitations in CLS activity assays?

CLS requires two substrates: CDP-diacylglycerol and phosphatidylglycerol. These can be challenging to obtain or synthesize in sufficient purity and quantity. Researchers can address this challenge through several approaches:

• Commercial sources: Purchase high-purity substrates from specialized lipid suppliers, though this can be expensive for large-scale studies.

• Enzymatic synthesis:

  • CDP-diacylglycerol can be enzymatically synthesized from phosphatidic acid using CTP:phosphatidate cytidylyltransferase

  • Phosphatidylglycerol can be enzymatically prepared from phosphatidylglycerophosphate

• Radiolabeled substrates: For sensitive detection in activity assays, commercially available radiolabeled precursors can be enzymatically converted to the required substrates.

• Alternative assay approaches:

  • Coupled enzyme assays that generate the substrates in situ

  • Complementation assays in CLS-deficient organisms as an indirect measure of activity

  • Mass spectrometry-based detection methods that require smaller amounts of substrate

• Substrate analogs: Testing simplified substrate analogs that maintain the essential structural features required for enzyme recognition but are easier to synthesize.

How does S. glossinidius CLS compare functionally with CLS enzymes from other bacteria and eukaryotes?

While specific comparative data for S. glossinidius CLS isn't provided in the search results, we can draw from studies of other CLS enzymes to suggest approaches for comparative analysis:

• Complementation studies: Testing whether S. glossinidius CLS can functionally complement CLS mutants from other species, similar to the studies showing that CrCLS1 complemented the Δcrd1 yeast mutant but not the bacterial pgsA mutant .

• Substrate specificity comparison: Analyzing whether S. glossinidius CLS shows preference for particular CDP-diacylglycerol or phosphatidylglycerol species compared to CLS enzymes from other organisms.

• Sequence comparison: Detailed analysis of the CDP-OH-P motif and surrounding regions between S. glossinidius CLS and other characterized CLS enzymes to identify conserved features. As shown in Figure 7 of the referenced study, there are specific sequence patterns that distinguish CLS from PGPS enzymes .

• Kinetic parameter comparison: Determining and comparing kinetic parameters (Km, Vmax, catalytic efficiency) of S. glossinidius CLS with those of other characterized CLS enzymes.

• Regulatory mechanism comparison: Investigating whether S. glossinidius CLS is regulated by similar factors (environmental stresses, metabolic conditions) as CLS enzymes from other organisms.

What can alignment of S. glossinidius CLS with other CDP-alcohol phosphotransferases reveal about substrate specificity determinants?

Sequence alignment analysis of S. glossinidius CLS with other CDP-alcohol phosphotransferases can provide valuable insights into substrate specificity determinants. Based on the information provided in the search results:

• Core motif analysis: The CDP-OH-P motif D(X)2DG(X)2AR(X)8-9G(X)3D(X)3D is conserved among both CLS and PGPS enzymes and is likely involved in CDP-DAG binding .

• CLS-specific patterns: Identification of residues or motifs that are specifically conserved among CLS enzymes but not in PGPS enzymes, which might be involved in PG recognition.

• PGPS-specific patterns: The search results identified a seven-amino acid motif (FxxAxxT) immediately preceding the core CDP-OH-P motif that is conserved among PGPS enzymes but not CLSs . Additionally, four other residues were found to be conserved specifically among PGPS enzymes . The absence of these residues in CLS enzymes, including S. glossinidius CLS, might contribute to their functional specificity.

• Structural context: Mapping these sequence differences onto structural models can help identify regions that form the substrate binding pockets and potentially explain substrate preferences.

• Evolutionary analysis: Examining patterns of sequence conservation and divergence across different taxonomic groups can reveal how substrate specificity evolved in this enzyme family.

What emerging technologies might advance our understanding of S. glossinidius CLS function and regulation?

Several cutting-edge approaches could significantly enhance our understanding of S. glossinidius CLS:

• Cryo-electron microscopy: This could reveal the detailed structure of S. glossinidius CLS, particularly how it interacts with membrane lipids and its substrates.

• Advanced lipidomics: Techniques like ion mobility mass spectrometry can provide detailed analysis of cardiolipin species produced by S. glossinidius CLS under different conditions.

• Single-molecule enzymology: These approaches could reveal the kinetic mechanism of CLS at unprecedented resolution.

• In vivo imaging: Fluorescently tagged CLS could be used to track its localization and dynamics within bacterial cells during different growth phases or stress conditions.

• CRISPR-based approaches: These could be adapted for precise genome editing in S. glossinidius to study CLS function in its native context.

• Systems biology approaches: Integrating transcriptomics, proteomics, and lipidomics data to understand how CLS functions within the broader metabolic network of S. glossinidius during symbiosis.

• Synthetic biology approaches: Engineering CLS variants with altered substrate specificity or regulation to understand structure-function relationships and potentially develop biotechnological applications.

How might research on S. glossinidius CLS contribute to understanding symbiotic relationships in insects?

Research on S. glossinidius CLS could provide valuable insights into symbiotic relationships:

• Membrane adaptation: Understanding how cardiolipin synthesis by S. glossinidius contributes to membrane adaptation within the host environment could reveal mechanisms of symbiont persistence.

• Metabolic integration: Studying how cardiolipin synthesis is integrated with host metabolism might reveal novel aspects of host-symbiont metabolic interdependence.

• Evolutionary adaptations: Comparing S. glossinidius CLS with those from free-living bacteria could reveal adaptations specific to the symbiotic lifestyle.

• Host immune interactions: Cardiolipin has been implicated in immune recognition in other systems; studying S. glossinidius CLS might reveal how the symbiont modifies its surface lipids to avoid or interact with host immunity.

• Developmental regulation: Investigating whether CLS activity varies during different host developmental stages could reveal synchronization mechanisms between symbiont and host life cycles.

These research directions could eventually inform strategies for manipulating insect-microbe interactions, with potential applications in controlling vector-borne diseases or improving beneficial symbioses in agricultural contexts.