Recombinant Sodalis glossinidius L-alanine exporter AlaE (alaE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
alaE; SG0439; L-alanine exporter AlaE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
alaE
Target Protein Sequence
MRWSCHPMSSVTSRLRSATADTFALVVYCFFTGMAIEILLSGMSLQQSLSSRVLAIPVNV IIAWPFGQYRDAVVSLASRHGPKQFWTRNLADLLAMSVFNHRSMRRFFLRWGWSGGSCSR RWSAMR
Uniprot No.

Target Background

Function
Exports L-alanine.
Database Links

KEGG: sgl:SG0439

STRING: 343509.SG0439

Protein Families
AlaE exporter family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the AlaE exporter and what is its significance in bacterial physiology?

AlaE (previously designated ygaW) is an inducible L-alanine export system that plays a crucial role in maintaining amino acid homeostasis in bacteria. In E. coli, this exporter prevents the toxic accumulation of intracellular L-alanine by facilitating its transport out of the cell. The significance of AlaE was initially demonstrated through experiments with dipeptide-hypersensitive mutants, which showed reduced L-alanine export rates and significant accumulation of intracellular L-alanine compared to parent strains . The physiological importance of AlaE is evidenced by the fact that when overexpressed in wild-type E. coli strains that do not intrinsically excrete alanine, the ygaW gene confers the ability to excrete this amino acid . This function is particularly important in environments where L-alanine or its precursors (like L-alanyl-L-alanine dipeptides) are abundant.

How does Sodalis glossinidius differ from E. coli in terms of metabolic capabilities?

S. glossinidius, as a maternally transmitted secondary endosymbiont of tsetse flies, exhibits significant differences in metabolic capabilities compared to free-living bacteria like E. coli due to its ongoing genome reduction process. While E. coli maintains robust, versatile metabolic networks capable of functioning under diverse environmental conditions, S. glossinidius shows reduced metabolic flexibility. Specifically:

Metabolic FeatureE. coli K12S. glossinidius
Functional status in minimal mediumFunctional (0.5391 gr DW/mmol glucose)Non-functional without L-arginine supplementation
Essential genes (single knockout)160204
Biosynthetic pathways integrityCompleteSeveral impaired pathways (incl. glycogen, arginine)
Robustness to mutationsHigherLower

What techniques are essential for expressing recombinant proteins from S. glossinidius?

When expressing recombinant proteins from S. glossinidius, researchers should consider several key methodological approaches:

  • Selection of appropriate expression systems: Since S. glossinidius has a reduced genome compared to free-living bacteria, expression in heterologous hosts like E. coli may be necessary. Selection of suitable promoters and vectors that accommodate the AT-rich nature of S. glossinidius genes is critical.

  • Codon optimization: S. glossinidius' ongoing genome reduction may have altered its codon usage patterns compared to E. coli . Codon optimization of the target gene may improve expression levels in heterologous hosts.

  • Culture conditions: For working directly with S. glossinidius, specialized conditions are required. The bacterium can be maintained in Mitsuhashi–Maramorosch (MM) medium supplemented with 20% heat-inactivated FCS at 25°C . For plate cultivation, MM agar plates under microaerophilic conditions (5% O₂/95% CO₂) are recommended .

  • Monitoring protein function: When studying membrane proteins like AlaE, functional assays measuring L-alanine transport rather than just protein expression become essential. Similar to the approach used for E. coli AlaE, researchers should measure both intracellular accumulation and export rates of L-alanine .

How might the function of AlaE in S. glossinidius differ from its E. coli counterpart in the context of host-symbiont interactions?

The function of AlaE in S. glossinidius likely reflects adaptations to its endosymbiotic lifestyle within tsetse flies. Unlike E. coli, which may encounter varying amino acid concentrations in diverse environments, S. glossinidius exists in the more stable but specialized environment of its insect host. Several factors could influence AlaE function in this context:

  • Metabolic complementarity: S. glossinidius shows reduced metabolic capabilities compared to free-living bacteria, having lost several biosynthetic pathways during genome reduction . AlaE may play a role in maintaining amino acid homeostasis not just within the bacterium but potentially in the symbiotic relationship with the host.

  • Regulation mechanisms: The expression of ygaW (alaE) in E. coli is induced by the presence of L-alanyl-L-alanine dipeptides . In S. glossinidius, regulation might be adapted to the specific amino acid fluxes encountered in the tsetse fly environment rather than responding to external dipeptides.

  • Integration with host metabolism: Given that S. glossinidius metabolic networks have evolved in the context of host integration, AlaE might function as part of a larger metabolic exchange system between symbiont and host, potentially exporting L-alanine that serves host functions.

  • Evolutionary trajectory: Based on reductive evolution simulations, proteins retained in host-dependent bacteria tend to be those essential for survival in the host niche . If AlaE is maintained in S. glossinidius despite genome reduction, this suggests it plays a crucial role in the endosymbiotic lifestyle.

What challenges might researchers face when attempting to characterize the structure-function relationship of recombinant AlaE from S. glossinidius?

Characterizing the structure-function relationship of recombinant AlaE from S. glossinidius presents several unique challenges:

  • Membrane protein purification: As a membrane transporter, AlaE requires specialized techniques for expression, purification, and structural characterization. Detergent selection and lipid reconstitution become critical considerations.

  • Functional differences due to genomic adaptation: S. glossinidius is undergoing genome reduction as it adapts to its host . This evolutionary process may have introduced subtle changes to AlaE that affect its function compared to the E. coli homolog, requiring comparative functional analyses.

  • Expression systems limitations: Standard expression systems may not replicate the cellular environment of S. glossinidius. The reduced metabolic capabilities of this bacterium suggest it exists in a different physiological state than free-living bacteria, which may affect protein folding and function.

  • Functional assay development: Assessing L-alanine export activity requires methods to quantify both intracellular accumulation and export rates . These must be adapted for the specific experimental system used for recombinant expression.

  • Physiological relevance interpretation: Connecting in vitro characterization to in vivo function requires understanding the metabolic context of S. glossinidius within its tsetse fly host, a complex biological system that may be difficult to replicate experimentally.

How might horizontal gene transfer have influenced the evolution of alaE in S. glossinidius?

The evolution of alaE in S. glossinidius likely reflects complex evolutionary processes including horizontal gene transfer (HGT). Several lines of evidence suggest this possibility:

  • Phylogenetic relationships: S. glossinidius shows close phylogenetic relationships with enteric pathogens like Shigella and Salmonella based on analyses of invasion genes . This suggests potential ancestral gene exchange between these lineages.

  • Evolutionary transition: S. glossinidius is believed to have evolved from an ancestor with a parasitic intracellular lifestyle, possibly a former entomopathogen . This transition from horizontally transmitted parasite to vertically transmitted endosymbiont could have involved acquisition of genes like alaE that facilitate adaptation to intracellular environments.

  • Maintenance despite genome reduction: The reductive evolution characteristic of endosymbiont genomes tends to eliminate non-essential genes . If alaE has been maintained in S. glossinidius despite genome reduction, this suggests it plays an essential role in the bacterium's adaptation to its host.

  • Functional convergence: The amino acid export function provided by AlaE may represent a common adaptation among bacteria that interact with eukaryotic hosts, potentially driving horizontal acquisition of this function through selective pressure.

To definitively characterize the evolutionary history of alaE in S. glossinidius, researchers would need to conduct comprehensive phylogenetic analyses comparing alaE sequences across related bacteria, examining synteny of surrounding genomic regions, and assessing sequence signatures indicative of horizontal transfer events.

What experimental approaches can be used to verify the function of recombinant S. glossinidius AlaE in heterologous systems?

Verifying the function of recombinant S. glossinidius AlaE requires multiple complementary approaches:

  • Complementation experiments: Transform alaE from S. glossinidius into E. coli mutants lacking functional alaE (similar to the experiments with E. coli ygaW) and test if it restores L-alanine export capability . Key measurements should include:

    • Intracellular L-alanine levels (expected to decrease with functional exporter)

    • Export rates using radiolabeled L-alanine

    • Growth phenotypes in the presence of L-alanyl-L-alanine dipeptides

  • In vitro transport assays: Reconstitute purified recombinant AlaE into liposomes and measure L-alanine transport directly. This approach requires:

    • Efficient protein purification while maintaining function

    • Appropriate liposome composition reflecting bacterial membrane properties

    • Sensitive detection methods for transported amino acids

  • Site-directed mutagenesis: Identify and modify conserved residues predicted to be important for transport function, then assess the impact on activity. This could include:

    • Comparing sequences of AlaE from S. glossinidius and E. coli to identify conserved regions

    • Creating systematic mutations in these regions

    • Testing mutant proteins using the complementation and in vitro assays described above

  • Expression analysis: Determine if S. glossinidius alaE expression is regulated similarly to E. coli alaE, which is induced by L-alanyl-L-alanine dipeptides . This could involve:

    • Creating reporter gene fusions with the alaE promoter region

    • Testing expression under various conditions relevant to the tsetse fly environment

How should researchers design experiments to study the role of AlaE in the context of S. glossinidius-tsetse fly symbiosis?

Studying AlaE in the context of host-symbiont interactions requires specialized experimental approaches:

  • Generation of S. glossinidius alaE mutants: Create targeted gene knockouts or mutations in S. glossinidius alaE. This is challenging but could be approached using:

    • Tn5 mutagenesis methods similar to those used for invC gene studies

    • CRISPR-Cas9 based genome editing adapted for S. glossinidius

    • Conditional knockdown approaches if complete deletion is lethal

  • Microinjection of modified symbionts: Following the established procedure for introducing genetically modified S. glossinidius into tsetse flies through intrathoracic microinjection , researchers can:

    • Introduce wild-type, mutant, or complemented strains into aposymbiotic flies

    • Track bacterial persistence in hemolymph and other tissues

    • Monitor vertical transmission to offspring

    • Assess host fitness parameters

  • Metabolomic analyses: Compare amino acid profiles in:

    • Hemolymph of flies carrying wild-type vs. alaE-mutant S. glossinidius

    • Tissues where S. glossinidius resides

    • S. glossinidius cells isolated from the host

  • Systems biology approach: Integrate experimental data with metabolic network models of S. glossinidius to predict the system-wide impact of AlaE function or dysfunction . This should include:

    • Flux balance analysis incorporating AlaE-mediated transport

    • In silico predictions of metabolic outcomes under different conditions

    • Validation of predictions with targeted metabolic measurements

Experimental ApproachKey MeasurementsExpected OutcomesChallenges
alaE mutant generationGrowth in culture, intracellular survivalPotential growth defects, reduced persistenceTechnical difficulty of genetic manipulation in S. glossinidius
Microinjection studiesBacterial load in hemolymph, vertical transmission ratesReduced fitness of alaE mutants, possible symbiosis effectsRequires specialized tsetse colony, microinjection expertise
MetabolomicsL-alanine levels in bacterial cells and host tissuesAltered amino acid homeostasis in mutantsRequires sensitive analytical methods, complex sample preparation
Systems biologyPredicted metabolic fluxes, growth ratesModel-based predictions of AlaE importanceAccuracy limited by existing knowledge of S. glossinidius metabolism

How should researchers interpret changes in amino acid transport when comparing recombinant AlaE from S. glossinidius versus E. coli?

When comparing amino acid transport mediated by AlaE from S. glossinidius versus E. coli, researchers should consider several factors in their data analysis and interpretation:

What statistical approaches are most appropriate for analyzing data from S. glossinidius AlaE functional studies?

The appropriate statistical approaches for analyzing data from functional studies of S. glossinidius AlaE depend on the experimental design and measurements being made:

  • For transport kinetics experiments:

    • Non-linear regression analysis for determining Km and Vmax parameters

    • Confidence interval estimation for kinetic parameters

    • Analysis of variance (ANOVA) to compare transport rates under different conditions

    • Multiple comparison tests with appropriate corrections for comparing different AlaE variants

  • For complementation studies:

    • Paired t-tests or ANOVA to compare intracellular L-alanine levels between strains

    • Repeated measures analysis for time-course export experiments

    • Survival analysis approaches for growth phenotype data under challenging conditions

  • For systems biology integration:

    • Sensitivity analysis to identify parameters most affecting model predictions

    • Flux variability analysis to determine the range of possible flux values through AlaE-mediated transport

    • Bayesian approaches to integrate experimental data with metabolic models

    • Statistical comparison of in silico predictions with experimental measurements

  • For experiments in the tsetse fly system:

    • Mixed effects models to account for variation between individual flies

    • Survival analysis for longevity data

    • Non-parametric methods for data that doesn't meet normality assumptions

    • Power analysis to determine appropriate sample sizes given the high variability inherent in complex biological systems

Regardless of the specific analysis, researchers should:

  • Clearly state all statistical assumptions

  • Use appropriate transformations for data that doesn't meet parametric test assumptions

  • Implement multiple comparison corrections when conducting numerous tests

  • Consider using bootstrapping or permutation-based approaches for complex datasets

What are the broader implications of studying AlaE in S. glossinidius for understanding bacterial adaptation and symbiosis?

Studying AlaE in S. glossinidius provides valuable insights into several fundamental biological processes:

  • Evolutionary trajectory of symbiont metabolism: S. glossinidius represents an intermediate stage in the evolution from free-living bacterium to obligate endosymbiont . Understanding how transporters like AlaE function and evolve during this transition illuminates the process of metabolic streamlining in host-adapted bacteria. The retention of AlaE despite genome reduction would suggest it plays an essential role in the symbiotic lifestyle.

  • Host-symbiont metabolic integration: The function of amino acid exporters like AlaE may reflect broader patterns of metabolic complementarity between symbionts and their hosts. By studying how AlaE contributes to amino acid homeostasis in both symbiont and host, researchers can better understand the molecular underpinnings of mutualistic relationships.

  • Bacterial adaptation mechanisms: The transition from horizontally transmitted parasite to vertically transmitted mutualist, as observed in S. glossinidius , represents a fundamental shift in bacterial lifestyle. Studying how transporters like AlaE function in this context provides insights into the molecular adaptations that facilitate such transitions.

  • Applications to synthetic biology: Understanding the minimal functional requirements for bacterial survival in specialized niches, as revealed through studies of S. glossinidius metabolism , could inform the development of engineered bacteria with streamlined genomes for biotechnological applications.

  • Vector biology and disease control: As a symbiont of tsetse flies, which vector trypanosomes causing sleeping sickness, understanding S. glossinidius biology could ultimately contribute to novel approaches for controlling vector-borne diseases. If AlaE plays a crucial role in the symbiotic relationship, it could potentially represent a target for symbiont-based control strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.