Recombinant Sodalis glossinidius Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Sodalis glossinidius Lipid A export ATP-binding/permease protein MsbA (msbA) is a heterologously expressed variant of the ATP-binding cassette (ABC) transporter MsbA, derived from the symbiotic bacterium Sodalis glossinidius. MsbA is essential for lipid A and lipopolysaccharide (LPS) transport in Gram-negative bacteria, ensuring proper outer membrane biogenesis and viability . This recombinant protein retains the functional domains required for ATP hydrolysis and lipid flipping, making it a critical tool for studying bacterial lipid transport mechanisms .

Functional Mechanism

MsbA utilizes ATP hydrolysis to drive lipid A/LPS flipping across the inner membrane via a "trap-and-flip" mechanism:

  1. Substrate binding: Lipid A enters the cytoplasmic-facing chamber via a large transmembrane portal (observed at 2.8 Å resolution in S. typhimurium) .

  2. ATP binding: NBD dimerization induces a conformational shift, closing the cytoplasmic chamber and opening the periplasmic exit .

  3. Lipid flipping: Hydrophobic acyl chains drag through the bilayer while polar headgroups remain sequestered .

  4. ATP hydrolysis: Resets the transporter to the inward-facing state .

Recombinant Applications and Research Findings

Recombinant S. glossinidius MsbA (UniProt: Q2NUA5) is produced in E. coli with optimized expression tags and storage conditions (Tris-based buffer, 50% glycerol) . Key applications include:

  • Drug resistance studies: Investigating ABC transporter-mediated antibiotic efflux .

  • Lipid transport assays: Validating lipid A flipping kinetics using fluorescence or EPR spectroscopy .

  • Structural biology: Cryo-EM and crystallography to resolve transport intermediates .

Table 2: Biochemical Properties of Recombinant S. glossinidius MsbA

PropertyDetail
Molecular Weight~65 kDa (monomer)
Expression SystemE. coli with L-arabinose induction
Purity>90% (SDS-PAGE verified)
Storage-20°C in Tris buffer; avoid freeze-thaw cycles

Research Significance and Future Directions

Recombinant MsbA is pivotal for:

  • Antibiotic development: Targeting lipid A transport disrupts outer membrane integrity in pathogens .

  • Mechanistic modeling: Resolving conformational transitions using EPR spectroscopy and molecular dynamics .

  • Biotechnological engineering: Repurposing ABC transporters for synthetic biology applications .

Outstanding questions include elucidating substrate-induced conformational changes in S. glossinidius MsbA and identifying species-specific transport regulators.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly indicate your requirement in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Please note: All protein shipments are delivered with standard blue ice packs. If dry ice shipment is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
msbA; SG0995; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-582
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
msbA
Target Protein Sequence
MLNDKDLSTWQTFRRLWPMISPFKTGLIVAAIALILNAASDTFMLSLLKPLLDDGFGKAN SNILVWMPLVVIGLMVLRGVSGFVSSYCVSWVSGKVIMNMRRRLFNHMMDMPVSFFDQQS TGTLLSRITYDSEQVASSSSGALITVIREGASIIGLFAMMFYYSWQLSLILVVIAPVVSF AIRQVSKRFRQISKRMQNTMGQVTTSAEQMLKGHKEVLIFGGQKVENERFNSVSNRMRQQ GMKMVAASSVSDPLIQFIASLALAFVLYAASFPSVMETLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFSILDMETEKDEGTVEVERVKGDIAFDHVTFSYPGKETPSLH DISLSIPTGHTVALVGRSGSGKSTIANLLTRFYDIQQGQILLDGTDLRAYKLASLRNQVA LVSQNVHLFNDTIANNIAYARKATYSRKQIENAARMAYAMDFIEKMDQGLDTVIGENGVL LSGGQRQRIAIARALLRDCPILILDEATSALDTESERAIQKALDALQKNRTSLVIAHRLS TIEKADEILVVVEGRIVERGNHEELMSRQGVYAQLHQLQFGQ
Uniprot No.

Target Background

Function
This protein is involved in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: sgl:SG0995

STRING: 343509.SG0995

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sodalis glossinidius and what is its biological significance?

Sodalis glossinidius is a secondary bacterial symbiont that colonizes various tsetse fly (Glossina) species, including Glossina palpalis gambiensis and Glossina morsitans morsitans. It represents an evolutionary intermediate transitioning from a free-living to a mutualistic lifestyle, as evidenced by its massive genome erosion and functional adaptations . The bacterium resides primarily intra- and extracellularly in the host midgut, but can also be detected in hemolymph . This symbiont is vertically transmitted to offspring and has been implicated in enhancing trypanosome susceptibility in tsetse flies, with some field studies showing that parasite-infected populations carry greater symbiont densities . The identical 16S rDNA sequences obtained from Sodalis from different tsetse host species suggest its relatively recent association with the tsetse host .

What is the function of the MsbA protein in bacteria?

MsbA is an essential ATP-binding cassette (ABC) transporter found in many Gram-negative bacteria, including Sodalis glossinidius. It functions primarily as a lipopolysaccharide (LPS) exporter, mediating the transbilayer movement of Lipid A anchor of lipopolysaccharides across the inner membrane . MsbA is among the earliest and most extensively studied ABC exporters with extensive structural and biochemical data available . In organisms like E. coli, MsbA is essential for viability due to the structural requirement of LPS in the outer membrane's outer leaflet . Beyond Lipid A transport, MsbA also exports various cytotoxic agents, contributing to its significance in bacterial physiology and potentially in symbiotic relationships .

How does the structure of MsbA relate to its function?

The functional MsbA transporter exists as a homodimer of identical half-transporters. Structurally, MsbA consists of:

  • Nucleotide-binding domains (NBDs) that share architectural elements with other ABC transporters but contain an X-loop (TEVGERV) that is specific to exporters

  • Transmembrane domains (TMDs) with intra-cytoplasmic loops (ICLs) that extend further into the cytoplasm than those in importers

  • A coupling interface where the NBD X-loops interact with coupling helices from each TMD to convert the chemical energy of ATP hydrolysis into mechanical energy for substrate translocation

The TMDs from opposite subunits are responsible for the majority of the interaction interface between the domains . The alternating access transport mechanism has been elucidated using cryoelectron microscopy and X-ray crystallography, providing insights into how structural changes drive substrate transport .

What methods are used to genetically modify Sodalis glossinidius for recombinant protein expression?

Genetic modification of Sodalis glossinidius can be achieved through multiple approaches:

  • Plasmid-based expression systems: Initial proof-of-concept studies demonstrated that S. glossinidius can be genetically engineered to express and release significant amounts of recombinant proteins using plasmid-based systems .

  • Chromosomal integration via Tn7-mediated transposition: For stable expression without antibiotic selection pressure, researchers use Tn7-mediated transposition to integrate target genes into the S. glossinidius chromosome . This method allows for strong and constitutive expression of recombinant proteins in the absence of antibiotic selection, which is crucial for in vivo applications .

  • Promoter selection: Constitutive promoters such as the lacZ promoter have been successfully used to drive expression of recombinant proteins in S. glossinidius .

  • Secretion signal incorporation: Addition of secretion signals (such as pelB) to recombinant proteins facilitates their secretion from the bacterial cell, as demonstrated with nanobody expression in S. glossinidius .

How can researchers establish stable chromosomal expression in S. glossinidius?

Establishing stable chromosomal expression in S. glossinidius typically involves:

  • Tn7-mediated transposition: This is the preferred method for generating recombinant S. glossinidius strains with chromosomally integrated genes . The technique allows for site-specific integration at a neutral chromosomal location.

  • Constitutive promoter selection: For sustained expression without induction, researchers utilize constitutive promoters such as the lacZ promoter .

  • Antibiotic-independent selection: Since antibiotic supplementation is not feasible under in vivo conditions, chromosomal integration eliminates the need for continued selection pressure to maintain the recombinant gene .

  • Verification of integration and expression: Western blot analysis is commonly used to confirm the expression of recombinant proteins following chromosomal integration .

What techniques are used to evaluate protein expression and function in recombinant S. glossinidius?

Several techniques are employed to evaluate recombinant protein expression and function:

  • Western blot analysis: This is the primary method used to confirm expression and secretion of recombinant proteins in S. glossinidius . For example, nanobody expression has been confirmed using this technique, as noted in S1 Fig referenced in search result .

  • Growth kinetics assessment: Comparing growth curves of recombinant strains to wild-type S. glossinidius helps determine if the genetic modification affects bacterial fitness . Research shows that recombinant S. glossinidius expressing nanobodies exhibits growth kinetics comparable to wild-type strains (S2 Fig referenced in result ).

  • Quantitative PCR (qPCR): This technique is used to quantify the recombinant bacterial densities in different tsetse fly tissues following colonization .

  • Functional assays: For MsbA specifically, ATP-dependent transport assays would be employed to assess the functionality of the recombinant protein.

How does MsbA utilize different energy sources for substrate transport?

MsbA exhibits a fascinating dual-energy utilization mechanism that combines two major cellular energy currencies:

  • ATP hydrolysis: Traditionally, ABC transporters like MsbA were thought to exclusively use the free energy from ATP binding and hydrolysis at the nucleotide-binding domains to drive conformational changes that transport substrates via the translocation pathway formed by the membrane domains .

  • Proton gradient coupling: Research has revealed that MsbA also utilizes transmembrane electrochemical proton gradients to drive substrate transport . This represents a significant finding that introduces ion coupling as a new parameter in the mechanism of this homodimeric ABC transporter.

  • Integrated energy utilization: The dependence of ATP-dependent transport on proton coupling, and the stimulation of MsbA-ATPase activity by the chemical proton gradient, highlight the functional integration of both forms of metabolic energy . This dual energy mechanism may provide adaptability advantages in varying environmental conditions.

What methodologies are used to measure ATP-dependency of MsbA transport?

Researchers employ several specialized techniques to measure ATP-dependency of MsbA transport:

  • Purified protein reconstitution: MsbA is purified and reconstituted into artificial membrane systems (liposomes or nanodiscs) to study its transport function in isolation.

  • ATP hydrolysis assays: Measuring ATPase activity using colorimetric assays that detect inorganic phosphate release to quantify the rate of ATP hydrolysis by MsbA.

  • Transport assays with fluorescent or radioactive substrates: These assays measure the movement of labeled substrates across membranes mediated by MsbA in the presence or absence of ATP.

  • Proton gradient disruption experiments: Using protonophores to collapse the proton gradient and assess how this affects ATP-dependent transport to demonstrate the coupling between the two energy sources .

  • Structural studies: Cryo-electron microscopy and X-ray crystallography of MsbA in different nucleotide-bound states to visualize conformational changes associated with the transport cycle .

How can recombinant S. glossinidius be used for paratransgenesis approaches against trypanosomes?

Recombinant S. glossinidius offers promising applications for paratransgenesis - the genetic modification of symbionts to express anti-pathogen molecules:

  • Expression of anti-trypanosomal molecules: S. glossinidius can be engineered to express and secrete molecules that target trypanosomes, such as nanobodies against trypanosome surface proteins . For example, nanobodies targeting the variant-specific surface glycoprotein (VSG) of bloodstream form trypanosomes or surface proteins of procyclic form trypanosomes have been expressed in recombinant S. glossinidius .

  • Targeting vulnerable parasite stages: Research indicates that targeting procyclic form trypanosomes in the tsetse midgut may be particularly effective, as they undergo a population bottleneck (three orders of magnitude decrease) 3-5 days after infection, providing a window of opportunity for intervention .

  • Colonization strategy: Intralarval microinjection of recombinant S. glossinidius has been shown to be essential for efficient colonization of tsetse fly tissues . This approach enables the introduction of the modified symbiont into third-instar larvae, which maintain the recombinant bacteria through pupation and adult emergence.

  • Evaluation of anti-trypanosomal activity: The efficacy of recombinant S. glossinidius expressing anti-trypanosomal molecules can be assessed through in vitro toxicity assays against trypanosomes and by monitoring trypanosome infection rates in colonized flies .

What is the relationship between S. glossinidius and trypanosome susceptibility in tsetse flies?

The relationship between S. glossinidius and trypanosome susceptibility is complex:

What are the potential roles of MsbA modification in anti-trypanosomal strategies?

Modification of MsbA in S. glossinidius could potentially contribute to anti-trypanosomal strategies through several mechanisms:

  • Altered lipopolysaccharide composition: Since MsbA is involved in Lipid A transport, modifications to MsbA could alter the LPS composition of S. glossinidius, potentially affecting its interactions with the tsetse immune system and indirectly influencing trypanosome establishment.

  • Co-expression platform: MsbA could potentially serve as a fusion partner or co-expression target with anti-trypanosomal molecules, leveraging its essential nature and membrane localization.

  • Transport of anti-trypanosomal compounds: Engineered variants of MsbA might potentially transport novel anti-trypanosomal compounds produced by recombinant S. glossinidius, enhancing their delivery within the tsetse environment.

What are the main challenges in working with recombinant S. glossinidius?

Working with recombinant S. glossinidius presents several technical challenges:

  • Maintaining genetic stability: Ensuring stable expression of recombinant genes in the absence of antibiotic selection pressure is challenging, necessitating chromosomal integration strategies .

  • Efficient colonization: Achieving efficient colonization of tsetse flies with recombinant S. glossinidius requires specialized techniques such as intralarval microinjection .

  • Expression level optimization: Balancing sufficient expression levels of recombinant proteins without imposing excessive metabolic burden on the bacterium is crucial for maintaining bacterial fitness and colonization ability.

  • In vivo monitoring: Tracking the recombinant bacteria and their expressed proteins in tsetse tissues requires specialized molecular tools and microscopy techniques.

  • Field application limitations: Translating laboratory success to field applications faces regulatory hurdles and ecological considerations regarding the release of genetically modified organisms.

How can researchers evaluate the impact of recombinant S. glossinidius on tsetse fly fitness?

Evaluating the impact of recombinant S. glossinidius on tsetse fly fitness involves several approaches:

  • Growth and development parameters: Monitoring pupation rates, emergence success, and developmental timing of flies carrying recombinant bacteria compared to controls.

  • Longevity assessment: Tracking adult fly survival to determine if the recombinant symbiont affects lifespan.

  • Reproductive capacity: Measuring fecundity, including larviposition rates and pupal weights, to assess reproductive fitness.

  • Feeding behavior: Evaluating blood meal acquisition and processing to identify any impacts on normal feeding.

  • Symbiont density quantification: Using qPCR to quantify recombinant and total S. glossinidius densities in different fly tissues over time to assess colonization dynamics and stability .

  • Competition with wild-type symbionts: Assessing the ability of recombinant S. glossinidius to compete with wild-type symbionts in mixed infections.

What future research directions should be pursued in recombinant S. glossinidius MsbA studies?

Future research on recombinant S. glossinidius MsbA could productively focus on:

  • Structure-function relationships: Detailed analysis of the structure-function relationships in S. glossinidius MsbA compared to other bacterial MsbA proteins, particularly focusing on adaptations related to the symbiotic lifestyle.

  • Energy coupling mechanisms: Further investigation of the dual energy utilization (ATP and proton gradient) by MsbA in the context of the tsetse symbiotic environment .

  • Role in symbiosis: Exploring how MsbA and Lipid A export contribute to the establishment and maintenance of the symbiotic relationship between S. glossinidius and tsetse flies.

  • Engineered variants: Developing engineered MsbA variants with altered substrate specificity or transport efficiency to enhance the delivery of anti-trypanosomal compounds.

  • Integration with other symbiont systems: Investigating potential interactions between S. glossinidius MsbA function and other tsetse symbionts, such as Wigglesworthia glossinidia.

  • Field application studies: Designing and implementing field trials to assess the effectiveness and ecological impact of recombinant S. glossinidius strains with modified MsbA in natural tsetse populations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.