Recombinant Sodalis glossinidius Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Sodalis glossinidius Lipoprotein Signal Peptidase (LspA) is a bacterial enzyme cloned and expressed in heterologous systems, primarily for research into bacterial physiology, symbiosis, and therapeutic target development. LspA (EC 3.4.23.36), also termed Prolipoprotein Signal Peptidase or SPase II, catalyzes the cleavage of signal peptides from pro-lipoproteins, enabling lipoprotein maturation and membrane localization in Gram-negative bacteria like S. glossinidius . This enzyme is critical for bacterial membrane integrity, immune evasion, and pathogen-host interactions, particularly in symbiotic or pathogenic contexts .

Biochemical Properties

AttributeDetail
Uniprot IDQ2NVY5
EC Number3.4.23.36
Gene NamelspA (SG0415)
Expression Region1–168 amino acids (N-terminal catalytic domain)
Amino Acid SequenceMNRTIMSTGLRWLWLALVVLALDLGSKQWVMTHFWLGESVPVIPFINFTYAHNPGAAFSF... (partial)
Molecular WeightNot explicitly stated; inferred as ~18 kDa (based on homologs)

LspA belongs to the aspartic acid protease family, with conserved catalytic aspartates critical for signal peptide cleavage . Its role in S. glossinidius aligns with its function in other Gram-negative bacteria, where lipoproteins anchor to membranes and mediate nutrient uptake or virulence .

Recombinant Expression and Handling

ParameterSpecification
Expression HostE. coli (implied by recombinant production methods)
Tag TypeUndetermined during production (variable per batch)
Storage BufferTris-based buffer with 50% glycerol
Storage Conditions-20°C (long-term), -80°C (extended storage); aliquots at 4°C for ≤1 week
Stability NotesAvoid repeated freeze-thaw cycles

Recombinant LspA is supplied at 50 µg quantities, with custom scales available upon request . The enzyme’s recombinant form retains functional activity, as inferred from its use in biochemical assays (e.g., lipoprotein processing studies) .

Role in S. glossinidius Biology

S. glossinidius is a maternally transmitted endosymbiont of tsetse flies, critical for their survival and implicated in trypanosome susceptibility . While LspA itself has not been directly studied in S. glossinidius, its homologs in pathogens like Staphylococcus aureus and Escherichia coli are validated targets for antibiotics (e.g., globomycin) that disrupt lipoprotein biosynthesis, compromising membrane integrity .

Cross-Species Insights

SpeciesLspA FunctionTherapeutic Relevance
Staphylococcus aureusEssential for lipoprotein maturation; targeted by globomycinAntibiotic development against MRSA
Escherichia coliInvolved in outer membrane stability; resistance linked to Lpp downregulationAntimicrobial strategies against uropathogens
S. glossinidiusLikely role in symbiont-midgut interaction and immune evasionParatransgenic applications in tsetse control

In S. glossinidius, LspA may facilitate lipoprotein secretion, enabling survival in the tsetse midgut and hemolymph. Genetic studies on S. glossinidius have focused on symbiosis-related genes (e.g., Type III secretion systems), but LspA remains a candidate for future paratransgenic strategies to block trypanosome transmission .

Optimal Conditions

StepProtocol
Long-Term StorageAliquot into single-use vials; store at -20°C or -80°C
Short-Term UseThaw aliquot at 4°C; discard after 1 week
Freezing/ThawingAvoid repeated cycles to prevent aggregation or activity loss

The recombinant protein is stabilized in glycerol to prevent denaturation but should not be exposed to temperatures >4°C during working cycles .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; SG0415; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
lspA
Target Protein Sequence
MNRTIMSTGLRWLWLALVVLALDLGSKQWVMTHFWLGESVPVIPFINFTYAHNPGAAFSF LADIGGWQRWAFSAIAVVIAVVLLVMMYRSDKRARLSNAAYAMIIGGALGNLFDRMVHGV VIDFIDFYVGNWHWPTFNVADVGICIGAVLIVLEGFCRPAGKTASQKG
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links

KEGG: sgl:SG0415

STRING: 343509.SG0415

Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sodalis glossinidius and why is it significant in endosymbiont research?

Sodalis glossinidius is a maternally inherited, Gram-negative bacterial endosymbiont of tsetse flies (Glossina spp.; Diptera: Glossinidae). It maintains a stable, chronic association with its insect host and undergoes predominantly maternal transmission . The significance of S. glossinidius in research stems from its unique genomic features and evolutionary state. The genome has undergone extensive degeneration as a result of its ecological transition from free-living existence to permanent host association, with approximately 40-50% of its genome consisting of pseudogenes . This makes S. glossinidius an excellent model system for studying the early stages of symbiosis evolution, as it represents an intermediate stage between free-living bacteria and obligate endosymbionts with highly reduced genomes .

What is Lipoprotein signal peptidase (LspA) and what role does it play in bacterial physiology?

Lipoprotein signal peptidase (LspA) is an aspartyl protease that cleaves the transmembrane helix signal peptide of lipoproteins as part of the lipoprotein-processing pathway . This enzyme plays a critical role in bacterial membrane physiology by processing lipoproteins for proper localization and function. The significance of LspA extends beyond basic bacterial physiology to biomedical applications, as members of the lipoprotein-processing pathway are excellent targets for antibiotic development because they are:

  • Essential in Gram-negative bacteria

  • Important for virulence in Gram-positive bacteria

  • Less likely to develop antibiotic resistance

The enzyme exhibits remarkable conformational dynamics, fluctuating on the nanosecond timescale between open and closed conformations, which allows it to accommodate and process a variety of substrates .

Why would researchers be interested in recombinant expression of S. glossinidius LspA?

Researchers are interested in recombinant S. glossinidius LspA for several compelling scientific reasons:

  • Antibiotic Development: As LspA is essential in Gram-negative bacteria and important for virulence in Gram-positive bacteria, studying the structure and function of S. glossinidius LspA can provide insights for developing novel antibiotics that target this enzyme .

  • Evolutionary Biology: Comparing LspA from S. glossinidius (an organism undergoing genome reduction) with LspA from free-living bacteria can illuminate how essential proteins evolve under symbiotic conditions .

  • Structural Biology: The conformational dynamics of LspA make it an interesting target for understanding membrane protein flexibility and function, with implications for substrate recognition and catalysis .

  • Host-Symbiont Interactions: Studying the role of LspA in processing S. glossinidius lipoproteins may provide insights into how this organism interacts with its tsetse fly host at the molecular level .

What genetic modification techniques are available for S. glossinidius to express recombinant LspA?

  • Bacteriophage P1 Transduction: P1 can infect, lysogenize, and promote transduction in S. glossinidius. This technique allows efficient delivery of replication-competent and suicide vectors for genetic manipulation . The process involves:

    • Packaging plasmid DNA containing the LspA gene into P1 virions in an E. coli P1CM clr-100(ts) lysogen

    • Delivering these phagemids to S. glossinidius cells

    • Selecting transductants using appropriate antibiotics

  • Conjugation: DNA transfer via bacterial conjugation has been established for S. glossinidius . This method can be used for:

    • Delivery of replication-deficient suicide plasmids designed for targeted gene disruption

    • Introduction of expression vectors containing the LspA gene

    • Campbell-like integration of vectors into the chromosome through homologous recombination

  • Chromosome Tagging: Specific tools have been developed for tagging the S. glossinidius chromosome with fluorescent genes at the Tn7 attachment site, which can be adapted for expression of recombinant proteins .

What are the optimal growth conditions for culturing S. glossinidius for recombinant protein expression?

The optimal growth conditions for S. glossinidius culture are critical for successful recombinant protein expression:

Culture Medium: Brain-heart infusion (BHI) broth supplemented with 10 mM MgCl₂ or brain-heart infusion agar (1.2% w/v) supplemented with 10% defibrinated horse blood and 10 mM MgCl₂ (BHIB) .

Growth Parameters:

  • Temperature: 27°C

  • Aeration: Growth in liquid medium should be carried out with aeration (250 rpm)

  • Atmosphere: Microaerophilic conditions are required for growth on BHIB, achieved either using BD GasPak EZ Campy Gas Generating sachets or a gas mixture (5% oxygen, 95% CO₂)

Antibiotic Selection: When using antibiotic resistance markers, the following concentrations are recommended for S. glossinidius :

  • Chloramphenicol: 10 μg/mL

  • Kanamycin: 25 μg/mL

  • Spectinomycin: 30 μg/mL

  • Gentamycin: 9 μg/mL

Culture ParameterOptimal Condition
MediumBHI broth with 10 mM MgCl₂
Solid MediumBHIB with 10% horse blood
Temperature27°C
Aeration250 rpm
AtmosphereMicroaerophilic (5% O₂, 95% CO₂)
Growth TimeLonger than E. coli (S. glossinidius grows slowly)

How can researchers verify the correct expression and folding of recombinant S. glossinidius LspA?

Verification of proper expression and folding of recombinant S. glossinidius LspA requires a multi-faceted approach:

  • Expression Confirmation:

    • Western blotting using antibodies against LspA or epitope tags

    • Mass spectrometry to confirm the identity of the expressed protein

    • Reporter gene fusion (e.g., with GFP) to visualize expression

  • Functional Assays:

    • Enzymatic activity assays measuring the cleavage of signal peptides from lipoproteins

    • Complementation of LspA-deficient strains to restore lipoprotein processing

  • Structural Analysis:

    • Electron paramagnetic resonance (EPR) to analyze conformational dynamics, as used in previous LspA studies

    • Molecular dynamics (MD) simulations to complement experimental data on protein folding and dynamics

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

  • Membrane Localization:

    • Fractionation studies to confirm proper membrane integration

    • Fluorescence microscopy if using fluorescent protein fusions

How does the conformational dynamics of LspA impact its function and potential as an antibiotic target?

The conformational dynamics of LspA are central to its function and critical for understanding its potential as an antibiotic target:

Key Conformational States:
LspA exhibits at least three distinct conformational states with different functional roles :

  • Closed Conformation: In the apo (unbound) state, LspA predominantly adopts its most closed conformation, where the periplasmic helix (PH) and β-cradle are approximately 6.2 Å apart. This conformation completely occludes the charged and polar active site residues from the lipid bilayer .

  • Intermediate Conformation: This conformation is stabilized when the antibiotic globomycin is bound and may represent the clamped substrate-bound state .

  • Open Conformation: This conformation creates a trigonal cavity where the lipoprotein, signal peptide, and diacylglyceryl moiety of the lipoprotein substrate can bind. It is the only conformation that would sterically allow the prolipoprotein to enter and bind in the correct orientation for signal peptide cleavage .

Implications for Antibiotic Development:
The plasticity of LspA and its binding sites presents both challenges and opportunities for drug development:

  • Understanding the equilibrium between these conformational states is essential for designing inhibitors that can effectively target LspA .

  • The antibiotic globomycin stabilizes an intermediate conformation that inhibits signal peptide cleavage and substrate binding .

  • A hybrid experimental design using molecular dynamics (MD) and electron paramagnetic resonance (EPR) has facilitated identification of protein conformations not observed in crystal structures, which will aid future development of therapeutics .

What challenges might researchers encounter when attempting to express and purify recombinant S. glossinidius LspA?

Researchers working with recombinant S. glossinidius LspA face several significant challenges:

  • Membrane Protein Expression:

    • LspA is a membrane protein, which typically presents difficulties in expression and purification

    • The hydrophobic nature of membrane proteins often leads to aggregation or misfolding

    • Expression levels may be low due to toxicity or cellular stress

  • S. glossinidius Specific Challenges:

    • S. glossinidius has undergone genome degeneration, potentially affecting protein folding machinery

    • The bacterium grows slowly under laboratory conditions, making large-scale protein production time-consuming

    • S. glossinidius is refractory to harsh artificial DNA transformation procedures due to the loss of stress response pathways

  • Protein Purification Issues:

    • Detergent selection is critical for maintaining LspA structure and function during solubilization

    • Native lipid environment may be required for proper folding and function

    • Multiple conformational states of LspA may complicate structural and functional studies

  • Activity Preservation:

    • The nanosecond timescale conformational dynamics are essential for function and may be disrupted during purification

    • The assay conditions must mimic the natural membrane environment to observe physiologically relevant activity

How can molecular dynamics (MD) simulations and electron paramagnetic resonance (EPR) be integrated to study S. glossinidius LspA conformational changes?

The integration of MD simulations and EPR represents a powerful approach for studying S. glossinidius LspA conformational dynamics:

Complementary Methodologies:

  • EPR Techniques:

    • Continuous Wave (CW) EPR can detect motion on the nanosecond timescale, appropriate for studying LspA dynamics

    • Double Electron-Electron Resonance (DEER) EPR measures distance distributions between labeled sites, revealing different conformational populations

    • Site-directed spin labeling allows specific regions (like the periplasmic helix) to be monitored

  • MD Simulation Approaches:

    • All-atom simulations in explicit membrane environments can model LspA dynamics

    • Enhanced sampling techniques can capture rare conformational transitions

    • Simulation of different states (apo, substrate-bound, inhibitor-bound) can reveal mechanism of action

Integration Strategy:

  • EPR-Guided Simulations:

    • EPR distance measurements can be used as constraints for MD simulations

    • CW EPR data on timescales of motion can validate simulation timeframes

  • Simulation Validation by EPR:

    • Conformations predicted by MD can be tested experimentally using strategic spin labeling sites

    • Predicted distances between residues can be measured by DEER EPR

  • Iterative Refinement:

    • Results from each method inform refinement of the other in an iterative process

    • Combined data allows construction of a complete conformational landscape

This hybrid approach has already proven valuable in LspA research, revealing conformations not observed in crystal structures alone .

What controls should be included when studying the activity of recombinant S. glossinidius LspA?

A robust experimental design for studying recombinant S. glossinidius LspA should include the following controls:

Negative Controls:

  • Catalytically inactive LspA mutant (e.g., mutation of active site aspartate residues)

  • Heat-denatured LspA to confirm the requirement for proper protein folding

  • Reactions without LspA to establish baseline activity

  • Reactions without substrate to detect any background signal

Positive Controls:

  • Well-characterized LspA from model organisms (e.g., E. coli LspA)

  • Known LspA inhibitor (globomycin) to demonstrate specific inhibition

  • Pre-validated substrate to ensure the assay is functioning properly

Expression Controls:

  • Western blot analysis to confirm expression levels

  • Fluorescent protein fusion to visualize localization

  • Mass spectrometry to verify protein identity

Structure-Function Controls:

  • EPR measurements of known conformational states

  • Comparison of wild-type and mutant LspA conformational dynamics

  • Parallel analysis of LspA from S. glossinidius and its free-living relative S. praecaptivus

How can researchers design experiments to investigate the interaction between LspA and potential inhibitors?

Designing experiments to investigate LspA-inhibitor interactions requires a comprehensive approach:

Binding Assays:

  • Isothermal Titration Calorimetry (ITC) to measure binding thermodynamics

  • Surface Plasmon Resonance (SPR) to determine binding kinetics

  • Fluorescence-based binding assays if suitable fluorescent probes can be introduced

Structural Studies:

  • EPR spectroscopy to determine how inhibitors affect conformational distributions

  • X-ray crystallography to obtain structures of LspA-inhibitor complexes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions involved in inhibitor binding

Functional Assays:

  • Enzyme inhibition assays with various concentrations of inhibitors to determine IC₅₀ values

  • Determination of inhibition mechanisms (competitive, non-competitive, uncompetitive)

  • Time-dependent inhibition studies to identify slow-binding or irreversible inhibitors

Computational Approaches:

  • Molecular docking to predict binding modes of inhibitors

  • MD simulations to investigate how inhibitors affect LspA dynamics

  • Virtual screening to identify novel inhibitor candidates

Cellular Studies:

  • Growth inhibition assays with S. glossinidius and related bacteria

  • Measurement of cellular lipoprotein processing in the presence of inhibitors

  • Assessment of membrane integrity and functionality with inhibitor treatment

What techniques can be employed to analyze the impact of LspA conformational changes on substrate specificity?

Understanding how LspA conformational changes affect substrate specificity requires specialized techniques:

Conformational Analysis Techniques:

  • EPR spectroscopy to monitor conformational distributions in different conditions

  • Single-molecule FRET to observe conformational dynamics in real-time

  • HDX-MS to identify regions with altered solvent accessibility in different states

Substrate Profiling Methods:

  • Synthetic peptide libraries representing different lipoprotein signal sequences

  • Mass spectrometry-based identification of cleaved substrates from cell lysates

  • Fluorogenic substrates with varying sequences to measure cleavage kinetics

Structure-Function Correlation:

  • Site-directed mutagenesis to alter residues involved in conformational changes

  • Chimeric proteins combining domains from LspA enzymes with different specificities

  • Correlation of EPR-determined conformational states with substrate preferences

Computational Approaches:

  • Molecular dynamics simulations of LspA with different substrates

  • Free energy calculations to compare binding energies of different substrates

  • Machine learning to identify sequence patterns preferentially cleaved in different conformational states

In vivo Validation:

  • Expression of mutant LspA variants in S. glossinidius or S. praecaptivus

  • Proteomic analysis to identify processed lipoproteins in vivo

  • Phenotypic assessment of cells expressing conformationally restricted LspA variants

How can recombinant S. glossinidius LspA research contribute to antibiotic development strategies?

Recombinant S. glossinidius LspA research offers significant potential for antibiotic development:

LspA as an Antibiotic Target:
LspA is considered an excellent target for antibiotic development because:

  • It is essential in Gram-negative bacteria

  • It is important for virulence in Gram-positive bacteria

  • It may not readily develop antibiotic resistance

Research Contributions to Drug Development:

  • Structural Insights:

    • Understanding the conformational dynamics of LspA provides a foundation for structure-based drug design

    • The identification of multiple binding modes for globomycin informs the design of more effective inhibitors

    • The discovery of three distinct conformational states (closed, intermediate, and open) offers multiple potential targeting strategies

  • Mechanism-Based Inhibitor Design:

    • Research on how globomycin stabilizes the intermediate conformation can guide development of similar inhibitors

    • Understanding how the periplasmic helix fluctuations affect active site accessibility can inform design of compounds that exploit this movement

  • Novel Screening Approaches:

    • Development of assays based on conformational changes rather than just enzymatic activity

    • High-throughput screens for compounds that lock LspA in inactive conformations

  • Resistance Prevention Strategies:

    • The essential nature of LspA in bacterial processes suggests lower potential for resistance development

    • Targeting multiple conformational states simultaneously could further reduce resistance potential

What role might recombinant S. glossinidius LspA play in developing paratransgenic approaches for tsetse fly-borne disease control?

Recombinant S. glossinidius LspA research has significant implications for paratransgenic disease control strategies:

Paratransgenesis Concept:
Paratransgenesis involves genetically modifying symbiotic bacteria within disease vectors to express molecules that interfere with pathogen development or transmission. Since S. glossinidius naturally inhabits tsetse flies, it presents an attractive platform for paratransgenic approaches to control tsetse-transmitted diseases like African trypanosomiasis .

Potential Applications of LspA in Paratransgenesis:

  • Modified LspA as a Processing Tool:

    • Engineered LspA could be used to process and display anti-trypanosome effector molecules on the S. glossinidius surface

    • LspA's role in lipoprotein processing could be exploited to anchor therapeutic proteins to the bacterial membrane

  • Vector Development:

    • Understanding of bacteriophage P1 transduction in S. glossinidius provides a mechanism for delivering engineered genes into symbiont populations in the field

    • LspA could serve as a model for studying the expression and function of recombinant proteins in S. glossinidius

  • Stability and Expression:

    • Research on how S. glossinidius LspA functions despite genome degradation provides insights into stable protein expression in this symbiont

    • Optimized expression systems based on this research could improve reliability of paratransgenic approaches

  • Monitoring Tools:

    • Techniques developed for studying recombinant LspA expression could be adapted to monitor the stability and spread of paratransgenic modifications in field populations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.