Recombinant Sodalis glossinidius Magnesium transport protein CorA (corA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
corA; SG2341; Magnesium transport protein CorA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-316
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
corA
Target Protein Sequence
MLNAFQLENHRLSRLDADEQGTLLDAVWVDLIEPGDDERERVQHELGQSLATRLELEDIE ASARFFEDEDGLHIHSFFFYADAEDHAGNATVAFTIRDGRLYTLRERELPAFRLYRMRTR SQTLIDGNVYELLLDLFETKIEQLADEIENIYSDLEALSLVIMDGHQGDEYDNALSTLAE LEDVGWKVRLCLMDTQRALNFLVRKARLPSGQLEQAREVLRDIESLLPHNESLFQKVNFL MQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELRWSFGYPGAIMLMI LAGLAPYLYFKRKNWL
Uniprot No.

Target Background

Function

This recombinant Sodalis glossinidius Magnesium transport protein CorA (corA) mediates the influx of magnesium ions. It also facilitates cobalt and manganese uptake. The protein alternates between open and closed conformational states, activated by low cytoplasmic Mg2+ levels and inactivated by high cytoplasmic Mg2+ levels.

Database Links

KEGG: sgl:SG2341

STRING: 343509.SG2341

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Sodalis glossinidius Magnesium Transport Protein CorA?

The Sodalis glossinidius magnesium transport protein CorA is a pentameric membrane channel that facilitates the transport of divalent metal ions, primarily Mg²⁺, across bacterial membranes. In S. glossinidius, CorA is encoded by the corA gene (locus tag SG2341) and represents one of the bacterium's primary mechanisms for maintaining magnesium homeostasis . This protein belongs to the broader CorA family, which is widely distributed across bacteria, archaea, and eukaryotic mitochondria.

How Does CorA Function in Magnesium Transport?

The CorA protein functions as a selective channel for divalent cations, with a particular affinity for Mg²⁺. The transport mechanism involves a complex interplay between protein conformation and ion selectivity. Unlike many other transport proteins that utilize ATP hydrolysis, CorA typically operates through a concentration gradient-dependent mechanism, facilitating the inward movement of magnesium ions along their electrochemical gradient.

Recent studies using small-angle neutron scattering (SANS), molecular dynamics simulations, and solid-state nuclear magnetic resonance spectroscopy have revealed that CorA exists in a dynamic equilibrium between multiple conformational states . Rather than simply transitioning between discrete "open" and "closed" forms based on magnesium binding, the protein appears to sample a range of conformations. This dynamic behavior is critical for understanding how the channel regulates ion flux.

In S. glossinidius, the function of CorA must be understood in the context of the bacterium's endosymbiotic lifestyle. The relatively static environment provided by the tsetse fly host may have influenced the evolution of magnesium transport systems in this organism, potentially leading to adaptations in CorA's regulation and function compared to free-living bacteria.

What Is the Relationship Between PhoP-PhoQ and Magnesium Transport in S. glossinidius?

The PhoP-PhoQ two-component regulatory system plays a crucial role in bacterial magnesium sensing and the regulation of various physiological processes. In S. glossinidius, PhoP-PhoQ has undergone significant evolutionary adaptations that appear to reflect the bacterium's transition to an endosymbiotic lifestyle. While PhoP-PhoQ directly regulates specialized magnesium transporters in many bacteria, its relationship with CorA in S. glossinidius is more complex.

The S. glossinidius PhoQ sensor kinase exhibits a substantially diminished ability to respond to magnesium as a repressing signal compared to homologs in other bacteria . This reduced sensitivity to magnesium means that PhoP-regulated genes remain expressed even in magnesium-rich environments. Interestingly, while S. glossinidius lacks intact copies of the PhoP-regulated magnesium transporters MgtA and MgtB (the latter being present only as a disrupted pseudogene), the remnant of mgtB still contains a canonical PhoP binding site . This suggests that in its evolutionary past, S. glossinidius used PhoP-PhoQ to coordinate magnesium transport gene expression.

While CorA is not directly regulated by PhoP-PhoQ in most bacteria, the alteration in magnesium sensing capabilities of the PhoP-PhoQ system in S. glossinidius may have systemic effects on magnesium homeostasis that indirectly influence CorA function. Furthermore, the retention of intact CorA while losing specialized PhoP-regulated transporters suggests an evolutionary shift toward reliance on constitutive magnesium transport systems in this endosymbiont.

How Do Conformational Changes in CorA Affect Its Function in S. glossinidius?

The relationship between CorA's conformational dynamics and its transport function represents a critical area of investigation. Recent research using small-angle neutron scattering (SANS) in combination with molecular dynamics simulations has revealed that CorA exists in a dynamic equilibrium between multiple conformational states, rather than simply alternating between distinct open and closed forms . This complexity has significant implications for understanding CorA function in S. glossinidius.

The conformational equilibria of CorA appear to be influenced by magnesium binding, but in a more nuanced manner than previously thought. Studies indicate that neither the Mg²⁺-bound closed structure nor the Mg²⁺-free open forms are sufficient to explain the average conformation of CorA in solution . Instead, the protein samples a range of conformations, with the population distribution shifting in response to magnesium availability. Even in the presence of magnesium, CorA maintains dynamic equilibrium between different non-conducting states, both symmetric and asymmetric, with conducting states becoming more populated in Mg²⁺-free conditions .

For S. glossinidius CorA specifically, these conformational dynamics must be considered in the context of the bacterium's endosymbiotic lifestyle. The relatively stable environment within the tsetse fly host may have influenced the evolutionary trajectory of CorA's regulatory mechanisms. Given the reduced magnesium sensing capability of the PhoP-PhoQ system in S. glossinidius , it's possible that CorA in this organism has adapted to function effectively under conditions where other magnesium homeostasis systems have altered sensitivity.

Research questions focusing on S. glossinidius CorA conformational dynamics might explore how the protein's behavior changes in response to various environmental factors relevant to the tsetse fly host environment, such as pH, temperature, or the presence of host-derived antimicrobial peptides. Additionally, investigating potential interactions between CorA and other membrane proteins specific to S. glossinidius could reveal unique adaptations in this endosymbiont.

What Methodological Approaches Can Be Used to Study Recombinant S. glossinidius CorA?

Studying recombinant S. glossinidius CorA presents both challenges and opportunities for researchers. Several methodological approaches can be employed to investigate various aspects of this protein's structure, function, and dynamics.

For genetic manipulation and expression of recombinant S. glossinidius CorA, lambda-Red mediated recombination has proven effective. This approach, as described in the literature, involves growing S. glossinidius harboring the pKD46 plasmid to an appropriate optical density, inducing lambda-Red functions with arabinose, and then transforming the cells with linear DNA using a heat-shock method . Following transformation, cells can be recovered overnight at 25°C in liquid medium before plating on selective media. This technique allows for precise genetic modifications, including gene deletions, insertions, or point mutations in the corA gene.

Structural analysis of recombinant S. glossinidius CorA can employ multiple complementary techniques. Small-angle neutron scattering (SANS) has been successfully used to investigate CorA conformational dynamics at room temperature, revealing the presence of multiple conformational states . This approach could be particularly valuable for studying how S. glossinidius CorA's conformational equilibria compare to those of CorA proteins from free-living bacteria.

Molecular dynamics (MD) simulations provide another powerful tool for investigating CorA dynamics. When combined with experimental structural data, MD simulations can generate detailed models of protein behavior that may not be directly observable through experimental methods alone. For S. glossinidius CorA, simulations could help elucidate how specific amino acid differences compared to other bacterial CorA proteins might influence the protein's conformational landscape and magnesium transport properties.

Solid-state nuclear magnetic resonance spectroscopy (NMR) has also been employed to study CorA dynamics, providing insights into backbone dynamics with and without magnesium . This approach could reveal specific regions of S. glossinidius CorA that exhibit altered dynamics compared to homologs from other bacteria, potentially identifying adaptation-related structural features.

How Can S. glossinidius CorA Be Used to Study Bacterial Evolution and Host Adaptation?

The study of S. glossinidius CorA offers unique opportunities to investigate bacterial evolution in the context of host adaptation. As a relatively recent endosymbiont, S. glossinidius represents an intermediate stage in the transition from a free-living lifestyle to obligate symbiosis, making it valuable for understanding how essential cellular processes adapt during this evolutionary trajectory.

The distribution of magnesium transport systems across different bacterial symbionts can be informative. As shown in Table 1, ancient insect endosymbionts like Wigglesworthia glossinidia, Blochmannia species, Carsonella ruddii, Buchnera species, and Baumannia cicadellinicola have entirely lost the PhoP-PhoQ two-component system and specialized magnesium transporters like MgtA and MgtB . This pattern suggests that as endosymbionts evolve, they may streamline their magnesium acquisition systems, potentially relying on host-derived mechanisms or simplified transport systems.

Table 1: Distribution of magnesium transport systems across bacterial symbionts

OrganismClassificationGenome size (Mbp)Age of Association (Myr)phoPphoQmgtAmgtBCorA/MgtE retained
Photorhabdus luminescensInsect pathogen5.68N.A.++-PNot specified
Arsenophonus nasoniaeInsect symbiont>3.56Unknown++--Not specified
Sodalis glossinidiusInsect symbiont4.17Unknown++-PYes (CorA, MgtE)
Candidatus Hamiltonella defensaInsect symbiont2.10Unknown--+-Not specified
Candidatus Serratia symbioticaInsect symbiont2.57Unknown++--Not specified
Wigglesworthia glossinidiaInsect symbiont0.6940-80----Not specified
Blochmannia spp.Insect symbiont0.70-0.7950----Not specified
Carsonella ruddiiInsect symbiont0.16120----Not specified
Buchnera spp.Insect symbiont0.42-0.65150----Not specified
Baumannia cicadellinicolaInsect symbiont0.68170----Not specified

(Adapted from data in search result , with "P" indicating pseudogene)

Research questions focusing on S. glossinidius CorA evolution might explore how selection pressures in the tsetse fly environment have shaped the protein's structure and function. Comparison with CorA proteins from closely related free-living bacteria could reveal adaptive changes specific to the endosymbiotic lifestyle. Additionally, investigating potential co-evolution between S. glossinidius CorA and tsetse fly host factors could provide insights into the molecular basis of this symbiotic relationship.

What are the Optimal Methods for Genetic Manipulation of S. glossinidius corA?

Genetic manipulation of S. glossinidius, including modifications to the corA gene, can be achieved through several approaches, with lambda-Red mediated recombination being particularly effective. The following methodology has been successfully employed for genetic modifications in S. glossinidius:

Lambda-Red mediated chromosomal insertions begin with cultures of S. glossinidius harboring the pKD46 plasmid, which carries the genes encoding the lambda-Red recombination system. These cultures are grown without shaking to an OD₆₀₀ₙₘ of approximately 0.2, then transferred to a shaking incubator and grown overnight until OD₆₀₀ₙₘ reaches 0.5 . The cells are pelleted, washed with 0.85% (w/v) NaCl, and resuspended in fresh medium supplemented with 0.5% (w/v) arabinose and 5 mM cAMP to induce the lambda-Red functions .

After induction, the cells are made chemically competent and transformed with linear DNA using a heat-shock method. Following overnight recovery, the cells are plated on appropriate selective media to identify recombinant clones. Putative recombinants are isolated as single colonies, and chromosomal insertions are confirmed by DNA sequencing .

For researchers working with corA specifically, designing linear DNA constructs with homology arms flanking the desired modification site in the corA gene is critical. These constructs can be generated using PCR with primers that incorporate the homology regions and any desired genetic modifications, such as point mutations, deletions, or insertions of reporter genes.

Following successful recombination, the lambda-Red plasmid (pKD46) can be cured from the recombinant strains by maintaining them in the absence of plasmid selection. Cultures are grown under these conditions for approximately 50 generations, with regular passages into fresh medium, before plating on selective media that only retain the chromosomal modification marker . Colonies can then be screened for ampicillin sensitivity to confirm loss of the pKD46 plasmid.

This approach allows for precise genetic manipulation of S. glossinidius corA, enabling studies of protein function through site-directed mutagenesis, domain deletions, or fusion to reporter genes. For studies of corA regulation, modifications to the promoter region can also be achieved using similar techniques.

How Can Functional Assays Be Designed to Study S. glossinidius CorA Activity?

Designing functional assays to study S. glossinidius CorA activity requires consideration of both the protein's transport function and the bacterium's unique physiological characteristics. Several approaches can be employed to investigate different aspects of CorA function:

Magnesium transport assays can be designed based on methods used for other bacterial species, with modifications to accommodate S. glossinidius growth requirements. One approach involves growing wild-type and corA mutant strains in media with varying magnesium concentrations, then measuring intracellular magnesium levels using fluorescent indicators or atomic absorption spectroscopy. Alternatively, radioactive ²⁸Mg²⁺ can be used to directly measure transport kinetics.

For researchers interested in CorA's role in antimicrobial peptide resistance, assays similar to those used for studying the PhoP-PhoQ system can be adapted. These involve growing S. glossinidius strains in defined media with different magnesium concentrations, then exposing the cells to antimicrobial peptides such as polymyxin B or cecropin A . Cell survival can be quantified by plating and counting colony-forming units (CFUs).

A detailed protocol for antimicrobial peptide resistance assays based on published methods involves:

  • Growing wild-type and corA mutant strains to mid-log phase in liquid medium

  • Harvesting cells by centrifugation (5,000 × g, 10 minutes, 4°C)

  • Washing cells twice with 0.85% (w/v) NaCl

  • Resuspending cells and inoculating into defined medium containing either high (10 mM) or low (10 μM) concentrations of MgCl₂ and CaCl₂

  • Incubating with shaking for 8 hours

  • Harvesting and washing cells again

  • Exposing cells to antimicrobial peptides (e.g., 50 μg/ml polymyxin B or cecropin A) for 10 minutes

  • Diluting and plating approximately 1,000 CFUs on appropriate media

  • Incubating plates for 5 days under microaerophilic conditions before counting colonies

For investigating CorA's conformational dynamics, biophysical techniques such as small-angle neutron scattering (SANS) can be employed. This approach has been successfully used to study CorA conformational states at room temperature, revealing the presence of multiple conformational equilibria . Preparing recombinant S. glossinidius CorA for SANS analysis typically involves expression and purification of the protein, followed by reconstitution in appropriate membrane mimetics.

Molecular dynamics simulations can complement experimental approaches, providing insights into CorA behavior that may be difficult to observe directly. These simulations require structural information as input, which can be obtained through homology modeling based on known CorA structures if experimental structures for S. glossinidius CorA are not available.

What Approaches Can Be Used to Study CorA Conformational Dynamics?

Understanding CorA conformational dynamics is crucial for elucidating its function as a magnesium transport protein. Several complementary approaches can be employed to investigate the conformational states and transitions of S. glossinidius CorA:

Molecular dynamics (MD) simulations provide atomic-level insights into protein dynamics over time. These computational approaches can reveal conformational transitions that may be difficult to capture experimentally. For S. glossinidius CorA, MD simulations could illuminate how specific residues contribute to conformational changes in response to magnesium binding or other stimuli. Combined with experimental data from techniques like SANS, MD simulations can help construct comprehensive models of CorA dynamic behavior .

Solid-state nuclear magnetic resonance (NMR) spectroscopy offers another approach for investigating protein dynamics. This technique has been successfully applied to study backbone dynamics in CorA both with and without magnesium . NMR can provide site-specific information about protein mobility and conformational exchange, potentially identifying regions of S. glossinidius CorA that undergo significant dynamic changes during transport cycles.

To fully characterize CorA conformational equilibria, these techniques should be applied under varying conditions relevant to S. glossinidius physiology. These might include different magnesium concentrations, pH values, membrane compositions, or the presence of other ions or molecules that might modulate CorA function in the context of the tsetse fly symbiosis.

When designing experiments to study S. glossinidius CorA conformational dynamics, researchers should consider the protein's behavior in its native membrane environment. While structural studies often employ detergent-solubilized proteins or reconstitution into artificial membrane systems, these environments may not perfectly recapitulate the native membrane context. Techniques that can probe CorA dynamics in intact bacterial membranes or membrane-mimetic systems that closely resemble the S. glossinidius membrane composition would be particularly valuable.

How Should Researchers Interpret SANS Data for CorA Conformational Analysis?

Interpreting small-angle neutron scattering (SANS) data for CorA conformational analysis requires careful consideration of both experimental parameters and theoretical models. SANS provides information about protein shape and dimensions in solution, making it valuable for studying conformational equilibria in membrane proteins like CorA.

SANS data for CorA typically yield scattering profiles that represent the average conformation of the protein population in solution. Research has shown that neither the Mg²⁺-bound closed structure nor the Mg²⁺-free open forms alone are sufficient to explain the average conformation of CorA . This suggests the presence of conformational equilibria between multiple states, requiring more complex interpretative approaches.

When analyzing SANS data for S. glossinidius CorA, researchers should consider employing ensemble modeling approaches. These involve generating a large pool of potential conformations through techniques like normal mode analysis or molecular dynamics simulations, then selecting subsets of these conformations that, when averaged, best match the experimental SANS profile. This approach can reveal which conformational states are populated under different experimental conditions.

For S. glossinidius CorA specifically, researchers should consider how the protein's behavior might differ from CorA homologs in other bacteria due to adaptations related to the endosymbiotic lifestyle. Comparative analysis with CorA proteins from free-living bacteria could highlight unique features of S. glossinidius CorA conformational dynamics.

What Approaches Can Address Contradictory Results in CorA Functional Studies?

Contradictory results in functional studies of S. glossinidius CorA may arise from various sources, including differences in experimental conditions, genetic backgrounds, or methodological approaches. Addressing these contradictions requires systematic investigation and careful experimental design.

One common source of contradictory results in membrane protein studies is the use of different expression systems or membrane environments. CorA function is highly dependent on its membrane context, and variations in lipid composition, membrane tension, or protein density can significantly affect its behavior. When comparing results across studies, researchers should carefully consider differences in how the protein was expressed, purified, and reconstituted.

For genetic studies of S. glossinidius CorA, differences in the genetic background of the strains used can lead to apparently contradictory results. S. glossinidius, like many bacteria, may have redundant transport systems that can compensate for CorA dysfunction to varying degrees depending on strain-specific genetic factors. Creating defined genetic backgrounds through precise gene deletions or complementation studies can help resolve these contradictions.

Experimental conditions, particularly magnesium concentration, can dramatically affect CorA behavior. Recent research has revealed that CorA exists in a dynamic equilibrium between multiple conformational states, with the population distribution influenced by magnesium availability . Studies conducted at different magnesium concentrations may sample different regions of this conformational landscape, leading to seemingly contradictory results.

A systematic approach to addressing contradictions involves:

  • Standardizing experimental conditions across studies

  • Using multiple complementary techniques to study the same phenomenon

  • Conducting experiments in both in vitro systems and in the native bacterial context

  • Developing quantitative models that can account for complex equilibria between multiple functional states

  • Considering species-specific adaptations that might cause S. glossinidius CorA to behave differently from homologs in other bacteria

For researchers studying recombinant S. glossinidius CorA, it is particularly important to consider how the protein's behavior might be influenced by its evolutionary context. The reduced magnesium sensing capability of the PhoP-PhoQ system in S. glossinidius suggests evolutionary adaptations to the endosymbiotic lifestyle that might extend to other magnesium homeostasis systems, including CorA.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.