Recombinant Sodalis glossinidius NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoA; SG1601; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
nuoA
Target Protein Sequence
MSITTEITAHYWAFAVFLLSALGLCVFMLTGGFLLGARARARSKNVPFESGIDPVGTARL RLSAKFYLVAMFFVIFDVETLYLYAWATAIREAGWVGFIEATIFILILLAGLVYLVRIGA LDWTPERSRRLRRAGPIGETPRHQE
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thus harnessing the redox energy in a proton gradient.

Database Links

KEGG: sgl:SG1601

STRING: 343509.SG1601

Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sodalis glossinidius and why is it significant for researchers?

Sodalis glossinidius is a microaerophilic secondary endosymbiont of the tsetse fly Glossina morsitans morsitans. It represents a significant research model due to its unique position in the evolutionary transition from a free-living to an obligate symbiotic lifestyle. The bacterium is fastidious, requiring complex nutritional requirements and specialized growth conditions, making it challenging but valuable for studying host-symbiont interactions . Researchers investigate S. glossinidius to understand symbiotic relationships, bacterial genome degeneration, and potential applications in paratransgenic insect control strategies aimed at reducing the transmission of parasitic trypanosomes by tsetse flies .

What is the structural composition of NADH-quinone oxidoreductase subunit A (nuoA) in Sodalis glossinidius?

The NADH-quinone oxidoreductase subunit A (nuoA) in Sodalis glossinidius is a membrane protein with a full amino acid sequence of: MSITTEEITAHYWAFAVFLLSALGLCVFMLTGGFLLGARARARSKNVPFESGIDPVGTARLRLSAKFYLVAMFFVIFDVETLYLYAWATAIREAGWVGFIEATIFILILLAGLVYLVRIGALDWTPERSRRLRRAGPIGETPRHQE . The protein is encoded by the nuoA gene (also identified as SG1601 in ordered locus names) and functions as part of the NADH dehydrogenase I complex (NDH-1). The protein has an expression region from amino acids 1-145 and contains transmembrane domains characteristic of respiratory chain components .

What are the optimal storage conditions for recombinant nuoA protein?

For optimal stability, recombinant Sodalis glossinidius NADH-quinone oxidoreductase subunit A should be stored at -20°C in a Tris-based buffer containing 50% glycerol that has been specifically optimized for this protein . For extended preservation, storage at -80°C is recommended. Researchers should avoid repeated freeze-thaw cycles as these can significantly degrade protein quality and activity. For ongoing experiments, working aliquots can be safely maintained at 4°C for up to one week . This approach minimizes protein degradation while ensuring consistent experimental results across multiple investigations.

How should researchers approach the culture of Sodalis glossinidius for nuoA studies?

Sodalis glossinidius requires specialized culture conditions due to its fastidious nature. Researchers should use rich medium formulations containing glucose or N-acetyl-D-glucosamine (NAG) as carbon sources . Initially, cultures should be maintained under anaerobic or microaerophilic conditions since S. glossinidius fails to grow on agar plates under atmospheric oxygen levels . Once cultures reach sufficient cell density (approximately OD600 ≈ 0.03), they can be transferred to a shaking incubator to significantly increase growth rates. Under optimal shaking conditions, cultures can reach an OD600 of ~0.9 in 2 days, compared to only ~0.14 in 6 days when maintained at rest . This approach leverages the bacterium's quorum-sensing system that regulates genes involved in oxidative stress response.

What genetic modification techniques are most effective for studying nuoA function in Sodalis glossinidius?

The lambda Red recombineering strategy has been successfully adapted for genetic manipulation of Sodalis glossinidius and represents the most effective approach for studying nuoA function . For optimal results, researchers should transform S. glossinidius with a plasmid harboring lambda Red functions under the control of an arabinose-inducible promoter (such as pKD46) using heat shock . When implementing this technique, several critical modifications are necessary: (1) Add 5 mM cAMP to overcome catabolite repression by glucose or NAG that can interfere with expression of genes under regulation of the PBAD promoter ; (2) Use shaking cultures to increase DNA replication rate, which enhances recombination efficiency; (3) Limit lambda Red gene induction to 0.5 hours to avoid potential mutagenic effects; (4) Use target sequence homology of at least 1 kbp for efficient recombination . The plasmid can be subsequently cured by growing cells at 25°C with shaking in the absence of plasmid selection, with over 98% of cells losing the plasmid after five passages .

How can researchers optimize expression systems for recombinant nuoA production?

For optimal expression of recombinant Sodalis glossinidius NADH-quinone oxidoreductase subunit A, researchers should consider the following methodological approach:

  • Expression System Selection: Due to S. glossinidius' fastidious nature, heterologous expression in E. coli is often preferable using vectors with tight regulation.

  • Growth Conditions: When using the endogenous system, implement the optimized growth conditions identified by Pontes et al., using shaking cultures once they reach OD600 ≈ 0.03 to activate oxidative stress responses .

  • Induction Parameters: If using arabinose-inducible systems, supplement with 5 mM cAMP to overcome catabolite repression by glucose or NAG, which can interfere with expression .

  • Membrane Protein Considerations: Since nuoA is a membrane protein, consider using specialized E. coli strains designed for membrane protein expression (such as C41/C43 derivatives).

  • Purification Strategy: Employ affinity chromatography with appropriate tag systems (determined during the production process) followed by size exclusion chromatography in detergent-containing buffers to maintain protein solubility and structure .

These methodological adaptations address the specific challenges of working with membrane proteins from fastidious bacteria and maximize yield while preserving biological activity.

What is the relationship between nuoA function and oxidative stress responses in Sodalis glossinidius?

While the search results don't directly detail the specific relationship between nuoA and oxidative stress in Sodalis glossinidius, we can establish a methodological framework based on the available information. NADH-quinone oxidoreductase (Complex I) plays a central role in respiratory chains and electron transport, which are directly linked to reactive oxygen species (ROS) generation and management. Pontes et al. demonstrated that S. glossinidius has a quorum-sensing system regulating numerous genes involved in oxidative stress response . Research into nuoA function should utilize this finding by:

  • Implementing genetically modified strains with altered nuoA expression using the optimized lambda Red recombineering approach.

  • Measuring ROS production and oxidative damage markers under varying oxygen conditions in wild-type versus nuoA-modified strains.

  • Analyzing growth characteristics when transitioning from microaerophilic to aerobic conditions.

  • Investigating potential interactions between nuoA and the quorum-sensing system using co-expression studies.

The finding that S. glossinidius cultures reach significantly higher cell densities when shifted to shaking conditions after reaching quorum suggests a coordinated metabolic adaptation to oxidative conditions , likely involving respiratory chain components like nuoA.

How can researchers integrate structural analysis of nuoA into functional studies?

To integrate structural analysis of Sodalis glossinidius nuoA into functional studies, researchers should implement a systematic methodology:

  • Computational Structure Prediction: Utilize the provided amino acid sequence (MSITTEEITAHYWAFAVFLLSALGLCVFMLTGGFLLGARARARSK...) to predict membrane topology and functional domains using tools like TMHMM, SWISS-MODEL, and AlphaFold2 .

  • Site-Directed Mutagenesis: Target conserved residues in the predicted functional domains using the lambda Red recombineering strategy optimized for S. glossinidius . This approach should focus on:

    • Creating point mutations in potential quinone-binding sites

    • Modifying residues in predicted membrane-spanning regions

    • Altering amino acids at potential subunit interfaces

  • Functional Assays: Develop assays to measure:

    • NADH dehydrogenase activity using spectrophotometric methods

    • Proton translocation efficiency

    • ROS production associated with electron leakage

  • Protein-Protein Interaction Studies: Investigate interactions between nuoA and other NADH dehydrogenase complex subunits using co-immunoprecipitation or bacterial two-hybrid systems.

This integrated approach combines structural insights with the genetic manipulation techniques specifically optimized for S. glossinidius to establish structure-function relationships for nuoA.

What are the common challenges in working with Sodalis glossinidius and how can they be addressed?

Researchers working with Sodalis glossinidius face several significant challenges that require specific methodological solutions:

  • Slow Growth Rate: S. glossinidius divides very slowly under standard culture conditions. Solution: Implement the optimized growth protocol developed by Pontes et al., where cultures are initially grown under microaerophilic conditions until reaching OD600 ≈ 0.03, then transferred to shaking incubation . This approach leverages the bacterium's quorum-sensing system and can increase growth rate significantly, achieving an OD600 of ~0.9 in 2 days versus ~0.14 in 6 days without shaking .

  • Fastidious Nutritional Requirements: The bacterium requires complex media formulations. Solution: Use rich medium containing glucose or N-acetyl-D-glucosamine as carbon sources .

  • Oxygen Sensitivity: S. glossinidius fails to grow on agar plates under atmospheric oxygen levels. Solution: Maintain anaerobic or microaerophilic conditions initially, then transition to aerobic conditions after sufficient cell density activates oxidative stress responses .

  • Genetic Manipulation Difficulties: Standard genetic techniques are often ineffective. Solution: Use the optimized lambda Red recombineering strategy, supplemented with 5 mM cAMP to overcome catabolite repression, and limit induction time to 0.5 hours to avoid mutagenic effects .

  • Contamination Susceptibility: S. glossinidius cultures are highly susceptible to contamination. Solution: Implement rigorous sterile technique and consider adding selective antibiotics when possible.

These methodological approaches address the unique biological characteristics of this fastidious symbiont while maximizing experimental success.

How can researchers validate the functionality of recombinant nuoA protein?

To validate the functionality of recombinant Sodalis glossinidius NADH-quinone oxidoreductase subunit A, researchers should implement a multi-faceted methodological approach:

  • Enzymatic Activity Assays: Measure NADH dehydrogenase activity (EC 1.6.99.5) using spectrophotometric methods tracking NADH oxidation and ubiquinone reduction . Compare activity of recombinant protein preparations to native membrane fractions from S. glossinidius.

  • Membrane Integration Verification: Confirm proper membrane insertion and topology using protease accessibility assays with membrane fractions or reconstituted proteoliposomes.

  • Complex Assembly Analysis: Evaluate proper incorporation into the NADH dehydrogenase complex using Blue Native PAGE, co-immunoprecipitation, or size exclusion chromatography.

  • Functional Complementation: Test whether the recombinant nuoA can restore function in nuoA-deficient bacterial strains, focusing on growth characteristics and respiratory chain function.

  • Structural Integrity Assessment: Use circular dichroism or limited proteolysis to verify proper folding of the recombinant protein.

This comprehensive validation protocol ensures both structural and functional authenticity of the recombinant nuoA protein before proceeding with further experimental applications.

How can nuoA studies contribute to understanding the symbiotic relationship between Sodalis glossinidius and tsetse flies?

Studying NADH-quinone oxidoreductase subunit A (nuoA) in Sodalis glossinidius can provide critical insights into the symbiotic relationship with tsetse flies through several methodological approaches:

  • Metabolic Integration Analysis: Investigate how nuoA function contributes to the bacterium's adaptation to the host environment. The lifestyle switch from facultative to obligate host association is accompanied by bacterial genome degeneration and reduced metabolic plasticity . Researchers can use lambda Red-mediated genetic modifications to study how alterations in nuoA affect bacterial survival within the tsetse fly host.

  • Oxidative Stress Response: The tsetse fly gut represents a challenging environment with varying oxygen levels. Since S. glossinidius has a quorum-sensing system regulating genes involved in oxidative stress response , researchers can investigate how nuoA participates in this adaptation by creating conditional nuoA mutants and measuring their survival under various oxidative conditions.

  • Energy Metabolism Adaptations: As part of the respiratory chain, nuoA plays a crucial role in energy production. Researchers can employ metabolomics approaches to compare energy metabolites in wild-type versus nuoA-modified strains within tsetse fly tissues.

  • Co-evolutionary Analysis: Compare nuoA sequences across Sodalis strains from different tsetse species to identify selection pressures and potential co-evolutionary signatures.

These methodological approaches provide mechanistic insights into how fundamental energy metabolism processes mediated by nuoA contribute to the establishment and maintenance of this important symbiotic relationship.

What potential does nuoA have in paratransgenic applications for vector control?

The potential of NADH-quinone oxidoreductase subunit A (nuoA) in paratransgenic applications for tsetse fly vector control can be methodologically explored through several research avenues:

  • Metabolic Manipulation Strategy: Researchers can engineer modified nuoA variants that alter energy metabolism in Sodalis glossinidius, potentially creating conditional strains that require specific supplements only available in laboratory settings. This approach would implement the lambda Red recombineering technique optimized for S. glossinidius to create strains with controlled growth characteristics within the tsetse fly host.

  • Expression Platform Development: The nuoA gene promoter region could be characterized and utilized as a constitutive or regulated expression platform for anti-trypanosomal effector molecules. This approach builds on previous work exploring paratransgenic control strategies for African trypanosomiasis .

  • Fitness Impact Assessment: Compare the colonization efficiency and vertical transmission rates of wild-type versus nuoA-modified S. glossinidius strains. This would involve creating specific knock-down or over-expression strains using the optimized genetic manipulation techniques described by Pontes et al. .

  • Integration with Quorum-Sensing Systems: Explore potential linkages between nuoA function and the quorum-sensing system previously identified in S. glossinidius , which could create opportunities for population-level control mechanisms.

These research directions would contribute to the development of paratransgenic strategies that use S. glossinidius as a platform to express transgenes that reduce the capability of tsetse flies to transmit parasitic trypanosomes .

How should researchers interpret changes in nuoA expression across different experimental conditions?

When interpreting changes in Sodalis glossinidius nuoA expression across different experimental conditions, researchers should implement a systematic analytical methodology:

  • Baseline Expression Establishment: First characterize nuoA expression under standard microaerophilic culture conditions in rich medium containing glucose or N-acetyl-D-glucosamine . This provides the reference point for comparative analyses.

  • Normalization Approach: Carefully select appropriate reference genes for qPCR normalization. Given S. glossinidius' unique lifestyle and genome degeneration , traditional housekeeping genes may not maintain stable expression across all conditions. Consider using multiple reference genes and geNorm/NormFinder analyses to select optimal normalizers.

  • Environmental Response Analysis: When analyzing expression changes during the transition from microaerophilic to aerobic conditions, consider the relationship with quorum-sensing systems previously identified in S. glossinidius . The significant increase in growth rate observed when cultures are transferred to shaking conditions likely reflects coordinated metabolic transitions involving respiratory chain components.

  • Integrated Data Interpretation: Correlate nuoA expression changes with:

    • Growth characteristics (doubling time, final cell density)

    • Metabolic parameters (oxygen consumption, NADH/NAD+ ratios)

    • Oxidative stress markers

  • Technical Considerations: When using arabinose-inducible systems for expression studies, remember that glucose and NAG can interfere with gene expression through catabolite repression . Always include 5 mM cAMP in experiments to overcome this effect, as demonstrated by Pontes et al. .

This methodological framework ensures robust interpretation of nuoA expression data within the context of S. glossinidius' unique biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.