Recombinant Sodalis glossinidius NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will fulfill your requests as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize the development of that tag.
Synonyms
nuoK; SG1592; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
nuoK
Target Protein Sequence
MIPLSHGLILAAILFVLGLTGMIIRRNLLFMLLGLEIMINASALAFVVAGSYWGHADGQV MYILAVTLAAAEASIGLALLLQLHRRRRTLDIDSVSEMHG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, resulting in the translocation of four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy in the form of a proton gradient.
Database Links

KEGG: sgl:SG1592

STRING: 343509.SG1592

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sodalis glossinidius and its significance in research?

Sodalis glossinidius is a bacteriome-associated endosymbiont found in tsetse flies (Glossina spp.). It has gained significant research attention due to its potential association with trypanosome susceptibility in these flies. S. glossinidius presence varies across different tsetse species and geographic locations, with studies showing complex interactions among the symbiont, trypanosomes, and host characteristics. For instance, research has demonstrated that S. glossinidius presence may be associated with trypanosome infection, particularly T. congolense, though this relationship appears to be influenced by multiple factors including tsetse species, geographic location, and host sex and age . The bacterium's presence shows strong association with geographic location and tsetse species, making it an interesting model for studying host-symbiont-parasite interactions.

What is the function of NADH-quinone oxidoreductase subunit K (nuoK) in bacterial systems?

NADH-quinone oxidoreductase (also referred to as Complex I) represents an essential component of bacterial respiratory chains, functioning as the entry point for electrons in the electron transport chain. The nuoK subunit is one of multiple subunits that constitute this complex enzyme, specifically located in the membrane domain. In bacterial systems like Sodalis glossinidius, the nuoK subunit contributes to the proton-pumping machinery of Complex I, helping to establish the proton gradient necessary for ATP synthesis. Similar to mitochondrial NADH:ubiquinone oxidoreductase found in eukaryotes, bacterial NADH-quinone oxidoreductase complexes comprise multiple subunits that form a characteristic L-shaped structure with a hydrophilic domain in the cytoplasm and a hydrophobic domain embedded in the membrane .

How conserved is the nuoK subunit across bacterial species?

The nuoK subunit belongs to the core set of 14 conserved subunits of NADH-quinone oxidoreductase that are found across bacterial species. This conservation reflects the essential nature of this subunit for complex I functionality. Sequence analysis typically reveals higher conservation in functional domains directly involved in proton pumping or structural integrity. While the search results don't provide specific sequence conservation data for nuoK in Sodalis glossinidius, studies of related complexes in other organisms demonstrate that membrane-embedded subunits like nuoK often show evolutionary conservation in their transmembrane domains and functionally critical residues. For example, in Pichia pastoris, complex I contains 41 subunits, comprising 14 core (conserved) subunits and 27 supernumerary subunits , suggesting a similar pattern may exist in bacterial systems.

What expression systems are recommended for recombinant production of Sodalis glossinidius nuoK?

For recombinant expression of membrane proteins like nuoK from Sodalis glossinidius, several expression systems can be considered, each with specific advantages:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coliHigh yields, simple cultivation, genetic tools availablePotential toxicity, inclusion body formationUse C41(DE3) or C43(DE3) strains designed for membrane proteins; optimize induction conditions
Yeast (e.g., Pichia pastoris)Post-translational modifications, proper foldingLonger cultivation timeOptimize methanol induction protocols; use strong promoters
Insect cellsSuperior folding of complex proteinsHigher cost, technical complexityBaculovirus optimization; monitor cell viability
Cell-free systemsAvoids toxicity issues, rapidLower yields for membrane proteinsSupplement with detergents or nanodiscs

When working with nuoK, consider using affinity tags (His6, FLAG, or Strep-tag) positioned at either the N- or C-terminus, with flexible linkers to minimize interference with protein folding. For detergent screening during purification, start with mild detergents like DDM, LMNG, or digitonin to maintain protein-protein interactions if the goal is to preserve interactions with other Complex I subunits.

What are the recommended methods for verifying structural integrity of recombinant nuoK?

Verifying the structural integrity of recombinant nuoK requires multiple complementary approaches:

  • Biochemical analysis: Size-exclusion chromatography to assess protein aggregation and oligomeric state, combined with dynamic light scattering to evaluate homogeneity.

  • Spectroscopic methods: Circular dichroism (CD) spectroscopy to analyze secondary structure content, particularly the α-helical content expected for transmembrane domains. Intrinsic tryptophan fluorescence can assess tertiary structure integrity.

  • Functional validation: NADH:ubiquinone oxidoreductase activity assays using artificial electron acceptors. These assays can be adapted from methodologies used for studying NQO1 and NQO2, which catalyze similar two-electron reduction reactions of quinone-like compounds .

  • Reconstitution experiments: Incorporating purified nuoK into proteoliposomes or nanodiscs to verify membrane integration and function in a lipid environment.

  • Structural analysis: Cryo-electron microscopy may be more suitable than crystallography for membrane proteins like nuoK, especially when examining its position within the larger Complex I structure.

How can researchers assess the functionality of recombinant nuoK?

Functional assessment of recombinant nuoK requires both isolated subunit testing and evaluation within the context of the complete Complex I:

  • Electron transfer activity: Adapt assays from studies of NAD(P)H:quinone oxidoreductase enzymes, which measure the reduction of quinone substrates. For example, methodologies similar to those used for studying NQO1 and NQO2 could be employed, where enzyme activity is monitored by following the oxidation of NADH spectrophotometrically .

  • Proton translocation: For fully assembled complexes containing nuoK, measure proton translocation using pH-sensitive fluorescent dyes in reconstituted proteoliposomes.

  • Inhibitor sensitivity: Determine sensitivity to known Complex I inhibitors, which can indicate proper folding and integration of nuoK. For instance, research has shown that compounds like tacrine can inhibit quinone reductases , and similar approaches could be used to test nuoK-containing complexes.

  • Complementation studies: Express recombinant nuoK in nuoK-deficient bacterial strains to assess functional complementation.

  • Interaction studies: Verify interactions with other Complex I subunits using techniques such as co-immunoprecipitation or crosslinking mass spectrometry to ensure proper integration into the complex.

How might studying nuoK contribute to understanding Sodalis-trypanosome-tsetse interactions?

Investigating nuoK in Sodalis glossinidius could provide insights into the energetics of this endosymbiont and its role in tsetse-trypanosome interactions:

  • Metabolic integration: Since NADH-quinone oxidoreductase is central to energy metabolism, characterizing nuoK could reveal how Sodalis meets its energy requirements within the tsetse host environment.

  • Adaptation mechanisms: Comparing nuoK sequence and function across Sodalis strains from different tsetse populations might reveal adaptations related to varying host environments or trypanosome susceptibility patterns.

  • Symbiosis maintenance: Energy metabolism genes like nuoK may be under selection pressure during the establishment of symbiosis. Research has shown that Sodalis presence varies significantly across different tsetse species and geographic locations , suggesting potential metabolic adaptations.

  • Intervention targets: Understanding the role of nuoK in Sodalis survival could identify targets for symbiont control, potentially affecting trypanosome susceptibility in tsetse flies. Studies have found complex associations between Sodalis presence and trypanosome infection, particularly with T. congolense , making this pathway relevant for disease intervention strategies.

What analytical methods are recommended for studying protein-protein interactions involving nuoK within the Complex I structure?

For investigating protein-protein interactions involving nuoK:

MethodApplicationAdvantagesLimitations
Blue Native PAGEIdentification of intact complexesPreserves native interactionsLimited resolution of individual interactions
Crosslinking Mass Spectrometry (XL-MS)Mapping interaction interfacesCaptures transient interactionsRequires optimization of crosslinking conditions
Co-immunoprecipitationVerification of direct interactionsCan work with endogenous proteinsMay disrupt membrane protein interactions
FRET/BRETIn vivo interaction dynamicsReal-time analysis possibleRequires fluorescent tagging
Hydrogen-Deuterium Exchange MSDynamic interaction mappingProvides structural informationComplex data analysis
Cryo-EMStructural visualizationHigh-resolution structural dataTechnically demanding

When applying these methods to nuoK research, maintaining the membrane environment is crucial. Consider using mild detergents like digitonin that preserve protein-protein interactions within membrane complexes, or employ membrane mimetics such as nanodiscs or amphipols.

How can researchers distinguish between functional and non-functional forms of recombinant nuoK?

Distinguishing functional from non-functional recombinant nuoK requires multi-parameter assessment:

  • Activity assays: Measure NADH oxidation rates in reconstituted systems. Methodologies can be adapted from those used for studying NQO1 and NQO2 enzymes, which also catalyze electron transfer reactions involving quinones .

  • Structural assessment: Circular dichroism spectroscopy to verify secondary structure content, particularly the expected α-helical signature of membrane proteins.

  • Thermal stability analysis: Techniques like differential scanning fluorimetry (DSF) can assess protein stability, with functional proteins typically showing cooperative unfolding transitions.

  • Ligand binding: Verify binding of substrates or inhibitors using techniques like isothermal titration calorimetry (ITC) or microscale thermophoresis (MST).

  • Integration assessment: For nuoK to be functional, it must properly integrate into the membrane and/or the larger Complex I structure. Blue Native PAGE can assess incorporation into larger complexes.

  • Complementation testing: Express the recombinant nuoK in a nuoK-knockout bacterial strain to determine if it restores NADH-quinone oxidoreductase activity and respiratory growth.

What are the major challenges in studying membrane proteins like nuoK, and how can they be addressed?

Major challenges in studying membrane proteins like nuoK include:

  • Expression and purification: Membrane proteins often express poorly and can be toxic to host cells. Solutions include using specialized bacterial strains designed for membrane protein expression, inducible expression systems with tight regulation, and fusion partners that enhance solubility.

  • Maintaining native structure: Detergent-solubilized membrane proteins may not retain native conformations. Alternative approaches include amphipols, nanodiscs, or styrene-maleic acid lipid particles (SMALPs) that better mimic the native membrane environment.

  • Functional reconstitution: Assessing function often requires reconstitution into artificial membranes. Standardized protocols for proteoliposome preparation with defined lipid compositions can improve reproducibility.

  • Structural determination: Membrane proteins resist crystallization. Cryo-EM has emerged as a powerful alternative, allowing structural determination in near-native conditions without crystallization.

  • Study in context: nuoK functions as part of a multisubunit complex. Co-expression with interacting partners or isolation of entire complexes may be necessary for meaningful functional studies.

How might CRISPR-Cas9 techniques be applied to study nuoK function in Sodalis glossinidius?

CRISPR-Cas9 approaches for studying nuoK in Sodalis glossinidius could include:

  • Gene knockout studies: Creating nuoK knockout strains to assess the phenotypic consequences, particularly regarding bacterial fitness within the tsetse host environment.

  • Domain mapping: Generating targeted mutations in specific functional domains to identify critical residues for proton pumping, quinone binding, or subunit interactions.

  • Tagged variants: Introducing epitope tags or fluorescent protein fusions at the genomic locus to enable tracking of nuoK expression, localization, and interactions.

  • Regulatable expression: Creating strains with inducible nuoK expression to study the effects of varying protein levels on bacterial metabolism and host interactions.

  • Base editing: Making precise point mutations to assess the impact of naturally occurring polymorphisms on nuoK function.

Implementation challenges include developing efficient transformation protocols for Sodalis and optimizing CRISPR-Cas9 delivery systems for this non-model organism. Additionally, phenotypic assessment might require maintaining Sodalis in its natural tsetse host environment to observe relevant effects, as studies have shown that Sodalis-trypanosome interactions are complex and influenced by multiple factors .

What implications does nuoK research have for understanding broader endosymbiont-host interactions?

Research on nuoK has several implications for understanding endosymbiont-host relationships:

  • Metabolic integration: NADH-quinone oxidoreductase represents a critical component of bacterial energy metabolism. Understanding nuoK function provides insights into how endosymbionts like Sodalis have adapted their energy production to the host environment.

  • Co-evolutionary patterns: Comparing nuoK sequences across Sodalis strains from different tsetse populations could reveal signatures of selection related to host adaptation.

  • Symbiont establishment: Energy production capacity may be a determining factor in successful colonization of host tissues. Research has shown that Sodalis presence varies significantly across geographic locations and tsetse species , suggesting potential metabolic adaptations to different host environments.

  • Application to other systems: Methodologies developed for studying nuoK in Sodalis could be applied to investigating respiratory complexes in other endosymbionts, including those with medical or agricultural significance.

  • Intervention strategies: Knowledge of nuoK function could inform development of strategies to manipulate endosymbiont populations, particularly relevant given the association between Sodalis and trypanosome presence in tsetse flies , vectors of African trypanosomiasis.

How do researchers reconcile contradictory findings regarding Sodalis-trypanosome associations?

Research on Sodalis-trypanosome associations has produced seemingly contradictory results that require careful reconciliation:

  • Study-specific variables: The literature shows complex patterns in the association between Sodalis glossinidius and trypanosome presence. Some studies found associations only with certain trypanosome species or in specific tsetse species, while others found no association . These discrepancies may be explained by:

    • Methodological differences: Studies have used various detection methods ranging from microscopy to DNA probes to PCR-based assays, each with different sensitivity and specificity .

    • Geographic variation: Environmental factors specific to collection sites may influence both symbiont and parasite prevalence.

    • Tsetse species differences: Associations found in one tsetse species may not hold in another due to species-specific immune responses or physiological differences .

  • Multifactorial analysis: Recent research employing more complex statistical approaches (e.g., Generalized Linear Models and Multiple Correspondence Analysis) has revealed that the Sodalis-trypanosome relationship involves complex interactions with factors like geographic location, tsetse species, sex, and age .

  • Trypanosome species specificity: The association between Sodalis and trypanosomes appears to depend on the trypanosome species, with stronger associations found for T. congolense than for T. vivax , suggesting mechanism-specific interactions.

  • Contextual interpretation: Rather than viewing contradictory findings as invalidating previous work, researchers should consider them as revealing the complex ecological and physiological contexts in which these associations exist.

What methodological differences might explain variations in experimental results when studying nuoK?

When studying bacterial respiratory complex components like nuoK, methodological differences can significantly impact results:

Methodological FactorPotential ImpactStandardization Approach
Detergent selectionDifferent detergents vary in their ability to maintain native protein structure and functionSystematic detergent screening; reporting detailed conditions
Lipid environmentLipid composition affects membrane protein functionDefine standard reconstitution protocols with controlled lipid compositions
Expression systemDifferent hosts may process the protein differentlyCompare results across expression systems; validate in native organism when possible
Purification strategyTag position and purification conditions can affect activityReport detailed purification protocols; verify tag does not interfere with function
Activity assay conditionspH, temperature, and substrate concentrations affect enzymatic parametersEstablish standard assay conditions; report all parameters
Protein concentration measurementDifferent methods yield varying results for membrane proteinsUse multiple complementary methods; report the specific method used

For nuoK specifically, standardizing membrane mimetic systems is crucial since this protein functions within the membrane domain of Complex I. Additionally, when integrating datasets from different studies, researchers should carefully consider whether full Complex I or isolated subunits were studied, as the protein's behavior may differ significantly in these contexts.

What emerging technologies might advance our understanding of nuoK structure and function?

Several emerging technologies hold promise for advancing nuoK research:

  • Cryo-electron tomography: Enables visualization of membrane proteins like nuoK in their native cellular context without extraction or purification, potentially revealing physiologically relevant conformations and interactions.

  • Single-molecule FRET: Allows tracking of dynamic conformational changes during the catalytic cycle of Complex I, potentially identifying the specific role of nuoK in the proton-pumping mechanism.

  • AlphaFold and related AI structural prediction tools: Can model nuoK structure and its interactions with other Complex I subunits, generating testable hypotheses about functional domains.

  • Nanobodies and synthetic binding proteins: Can stabilize specific conformations of nuoK or Complex I for structural studies and potentially serve as crystallization chaperones.

  • Cell-free expression systems with expanded capabilities: Emerging systems optimized for membrane protein production could overcome expression challenges.

  • Direct evolution approaches: Can identify functional variants of nuoK with enhanced stability or activity, revealing structure-function relationships.

  • Mass photometry: Enables label-free characterization of membrane protein complexes, assessing heterogeneity and stoichiometry of complexes containing nuoK.

How might systems biology approaches enhance our understanding of nuoK in the context of Sodalis-tsetse interactions?

Systems biology approaches can contextualize nuoK function within the broader Sodalis-tsetse-trypanosome interaction network:

These approaches could help explain the complex associations observed between Sodalis presence and trypanosome infection in tsetse flies, which vary by geographic location, tsetse species, sex, and age .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.