Recombinant Sodalis glossinidius Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE (arnE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. For dry ice shipping, please contact us in advance as additional fees apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us. We will prioritize developing the specified tag if feasible.
Synonyms
arnE; SG1840; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; L-Ara4N-phosphoundecaprenol flippase subunit ArnE; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
arnE
Target Protein Sequence
MMYLLIFLVSLLSCAGQLCQKHAAGASSGAGELRHRVRWLAISLLLLGGAMLVWLWVLQR VPVGIAYPMFSLNFVLVTLAARWLWREPVSLRHGCGLLLIVAGVMCMGVNL
Uniprot No.

Target Background

Function
This protein facilitates the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane.
Database Links

KEGG: sgl:SG1840

STRING: 343509.SG1840

Protein Families
ArnE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of ArnE in Sodalis glossinidius?

ArnE (previously known as PmrM) functions as a subunit of the undecaprenyl phosphate-α-L-Ara4N flippase system that transports 4-amino-4-deoxy-L-arabinose (Ara4N) units across the inner bacterial membrane. This enzyme plays a critical role in the modification pathway of lipid A with Ara4N, which is essential for resistance against cationic antimicrobial peptides and polymyxin antibiotics in Gram-negative bacteria. In S. glossinidius, this mechanism likely contributes to its adaptation within the tsetse fly host environment by providing protection against host immune defenses . The flippase activity specifically mediates the translocation of the lipid-linked Ara4N precursor to the periplasmic face of the inner membrane, where the Ara4N moiety can be transferred to lipid A by ArnT.

How does ArnE integrate into the complete Ara4N modification pathway?

ArnE operates within a complex biochemical pathway that involves multiple enzymes working in sequence. The pathway begins with the conversion of UDP-glucose to UDP-glucuronic acid, followed by oxidative decarboxylation by ArnA to generate UDP-4-ketopentose. This intermediate is then transaminated by ArnB and subsequently N-formylated by ArnA to produce UDP-β-L-Ara4N-formyl. ArnC transfers the formylated Ara4N moiety to undecaprenyl phosphate, after which ArnD catalyzes the critical deformylation step. At this stage, ArnE and ArnF (formerly PmrL) collaborate as flippase subunits to transport the undecaprenyl phosphate-α-L-Ara4N to the periplasmic surface, where ArnT finally transfers the Ara4N group to lipid A .

What structural domains characterize ArnE and how do they contribute to its function?

While the search results don't provide specific structural details for ArnE from S. glossinidius, comparative analysis with related proteins suggests it likely contains multiple transmembrane domains characteristic of flippase subunits. By analogy with the extensively studied ArnD, which possesses a NodB homology domain with distinct features including a metal coordination H-H-D triad essential for its deformylase activity , ArnE might contain specialized domains for membrane insertion and substrate recognition. The membrane association of ArnE is crucial for its function in facilitating the translocation of the lipid-linked Ara4N precursor across the phospholipid bilayer, and specific amino acid residues likely mediate interactions with both the lipid substrate and partner protein ArnF.

What expression systems are most effective for producing functional recombinant ArnE?

Based on available information, expression of recombinant S. glossinidius ArnE requires specialized systems that account for its hydrophobic nature as a membrane protein. While commercial recombinant ArnE is available , research laboratories should consider membrane protein expression systems such as E. coli strains engineered for membrane protein production (e.g., C41/C43 or Lemo21). Expression constructs should incorporate fusion tags (His6, MBP, or SUMO) to facilitate purification and a signal sequence to ensure proper membrane targeting. Detergent solubilization protocols using mild detergents such as DDM or LMNG are recommended for extraction from membranes. For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary to maintain native-like lipid environments for proper folding and activity assessment.

How can researchers effectively measure ArnE-mediated flippase activity in vitro?

Flippase activity of recombinant ArnE can be measured using several complementary approaches. A validated method involves the use of membrane-impermeable labeling reagents such as N-hydroxysulfosuccinimidobiotin to quantify the concentration of undecaprenyl phosphate-α-L-Ara4N on the periplasmic surface of the inner membrane . Researchers have observed a 4-5 fold reduction in labeling in mutants lacking functional ArnE/F components, indicating impaired translocation of the substrate. Alternative methods include reconstituting purified ArnE and ArnF into proteoliposomes with fluorescently labeled lipid analogs and monitoring transbilayer movement through fluorescence quenching assays. For more precise quantification, mass spectrometry-based approaches can track the appearance of Ara4N-modified lipid A species in membrane preparations with reconstituted ArnE/F complexes.

What methods are available to study ArnE-ArnF protein interactions and complex formation?

To study the crucial interaction between ArnE and ArnF, researchers should employ a multi-method approach. Co-immunoprecipitation using epitope-tagged versions of both proteins can verify their physical association in membrane fractions. Advanced techniques like bimolecular fluorescence complementation (BiFC) or fluorescence resonance energy transfer (FRET) can provide spatial information about their interaction in living cells. For structural characterization, cryo-electron microscopy of the purified complex reconstituted in nanodiscs offers the highest resolution data. Functional complementation studies using individually expressed components in proteoliposomes can determine if both proteins are required for flippase activity. Additionally, bacterial two-hybrid systems adapted for membrane proteins can map specific interaction domains between ArnE and ArnF to guide mutagenesis studies for functional validation.

How does ArnE-mediated lipid A modification influence antimicrobial resistance profiles?

ArnE facilitates the critical translocation step required for Ara4N modification of lipid A, which directly impacts antimicrobial resistance through charge alteration of the bacterial surface. Modification with the positively charged Ara4N neutralizes the negative charges of lipid A phosphate groups, significantly reducing the electrostatic attraction of cationic antimicrobial peptides (CAMPs) and polymyxin antibiotics to the bacterial membrane . In experimental systems, knockout mutations in arnE genes result in polymyxin-sensitive phenotypes despite normal production of undecaprenyl phosphate-α-L-Ara4N, confirming the essential role of the flippase function. The table below summarizes the relationship between ArnE function and antimicrobial resistance:

ArnE StatusUndecaprenyl phosphate-α-L-Ara4N ProductionPeriplasmic TranslocationLipid A ModificationPolymyxin Sensitivity
FunctionalNormalEfficientPresentResistant
MutantNormalReduced (4-5 fold)AbsentSensitive
OverexpressedNormalEnhancedIncreasedHighly resistant

What role might ArnE play in the Sodalis-tsetse-trypanosome interaction triangle?

ArnE's function in S. glossinidius likely contributes to the complex tripartite relationship between the bacterium, its tsetse fly host, and trypanosome parasites. Studies have established a statistically significant association between S. glossinidius presence and trypanosome infections in tsetse flies (p < 0.001) , suggesting that the symbiont enhances vector competence for the parasite. The Ara4N modification pathway involving ArnE may enable S. glossinidius to resist host immune defenses, thereby establishing persistent infection. This persistent infection appears to create conditions favorable for trypanosome establishment, potentially through immunomodulation or metabolic alterations in the fly gut. Since S. glossinidius can be genetically engineered to express anti-trypanosome factors , targeting ArnE function could potentially disrupt this symbiosis and reduce vector competence. This approach represents a novel angle for symbiont-mediated control strategies against African trypanosomiasis.

What genetic engineering approaches are most appropriate for studying ArnE function in Sodalis glossinidius?

S. glossinidius is uniquely positioned as the only culturable gammaproteobacterial insect symbiont amenable to genetic modification , offering several approaches for investigating ArnE function. Tn7-mediated transposition has successfully generated recombinant S. glossinidius strains with chromosomally integrated genes under constitutive promoters , making this an ideal method for creating ArnE knockout, complementation, or tagged variants. CRISPR-Cas9 editing could provide more precise modifications to the native arnE gene. For functional studies, reporter fusions (such as ArnE-GFP) can track protein localization, while complementation with heterologous arnE genes can assess functional conservation. Since chromosomal integration eliminates the need for antibiotic selection pressure, these modified strains can be studied under in vivo conditions following microinjection into tsetse larvae, enabling assessment of ArnE's role in colonization efficiency and trypanosome susceptibility.

How could engineered versions of ArnE be utilized for symbiont-based vector control strategies?

Engineered modifications to ArnE could serve as a foundation for novel vector control strategies targeting African trypanosomiasis. Since the presence of S. glossinidius significantly increases tsetse susceptibility to trypanosome infections , creating attenuated strains with modified ArnE function could potentially reduce this effect. Alternatively, the S. glossinidius flippase system could be repurposed to export anti-trypanosomal compounds that interfere with parasite establishment in the fly gut. The table below outlines potential engineering strategies:

Engineering ApproachMechanismExpected OutcomeImplementation Challenges
ArnE knockout/attenuationReduced bacterial persistenceDecreased trypanosome susceptibilityMay affect symbiont fitness
ArnE-mediated export of anti-trypanosomal compoundsDirect targeting of parasiteBlocked trypanosome establishmentRequires modification of substrate specificity
ArnE fusion with immunomodulatory proteinsAltered host immune responseEnhanced tsetse resistance to trypanosomesComplex immune interactions
Dual-function ArnE variantsMaintained bacterial fitness with altered host effectsPersistent symbiont with reduced trypanosome enhancementRequires precise protein engineering

How has ArnE evolved in Sodalis glossinidius compared to related bacterial species?

The evolutionary trajectory of ArnE in S. glossinidius likely reflects the bacterium's transition from a free-living or pathogenic lifestyle to an endosymbiotic one. Phylogenetic analyses based on type III secretion system genes have consistently placed Sodalis in a well-supported clade containing enteric pathogens such as Shigella and Salmonella , suggesting that S. glossinidius evolved from an ancestor with a parasitic intracellular lifestyle. Despite substantial genome erosion with a reduced coding capacity of 51% and 972 pseudogenes , ArnE appears to have maintained its functionality, indicating its importance for symbiont survival. Comparative analyses would likely reveal adaptive modifications in the S. glossinidius ArnE sequence that optimize its function within the specific chemical environment of the tsetse fly, possibly including altered substrate specificity or regulatory mechanisms compared to homologs in free-living bacteria.

What does the conservation of ArnE in a reduced genome reveal about essential symbiont functions?

The retention of functional ArnE in the highly reduced genome of S. glossinidius provides valuable insights into essential functions for endosymbiotic lifestyle. With massive genome erosion documented in S. glossinidius , the preservation of intact arnE suggests strong selective pressure to maintain this function. This conservation likely reflects the critical role of antimicrobial peptide resistance in establishing persistent infection within host tissues. Comparative genomic analyses across multiple Sodalis strains from different tsetse species could reveal whether arnE shows signatures of positive selection or constraint. The pattern of gene retention in reduced endosymbiont genomes offers a natural experiment in identifying minimal functional requirements for specific ecological niches. In this context, ArnE represents a component of core machinery for host colonization that has withstood reductive evolutionary pressures, highlighting its potential as a target for symbiont-based control strategies.

How might the interplay between ArnE activity and host immunity influence symbiont population dynamics?

This complex question requires integrating multiple levels of analysis. ArnE-mediated lipid A modification likely influences recognition by host pattern recognition receptors, potentially modulating immune responses against S. glossinidius. Experimental approaches should include comparing immune responses to wild-type versus arnE mutant strains through transcriptomic analysis of tsetse immune genes and hemolymph antimicrobial peptide profiling. Time-course studies tracking bacterial populations in different host tissues following infection with labeled S. glossinidius variants would reveal how ArnE impacts colonization dynamics. Computational modeling could integrate these data to predict how fluctuations in host immunity might select for varied ArnE expression levels. This research direction would provide fundamental insights into the evolutionary stability of the symbiosis and identify potential intervention points for manipulating symbiont populations.

What methodological approaches can resolve contradictory findings regarding Sodalis-trypanosome associations across different tsetse species?

Studies have reported variable associations between S. glossinidius and trypanosome infections across different tsetse species and geographical regions. While a statistically significant relationship was found in G. pallidipes but not in G. swynnertoni from Kenya, and in G. m. morsitans from western Zambia but not from Luambe National Park , resolving these contradictions requires sophisticated methodological approaches. Researchers should implement standardized qPCR protocols for precise quantification of both S. glossinidius and trypanosome loads, coupled with next-generation sequencing to identify strain-level variations in symbiont populations. Controlled infection experiments using identical trypanosome strains across different tsetse species with known S. glossinidius status would eliminate confounding variables. Meta-analysis techniques combining data from multiple studies with appropriate statistical corrections for methodological differences could identify genuine biological patterns versus technical artifacts. Finally, population genetic approaches examining both symbiont and host genomes could reveal co-evolutionary signatures explaining the species-specific variation in these tripartite interactions.

What strategies can overcome common challenges in recombinant ArnE expression and purification?

Membrane proteins like ArnE present significant technical challenges requiring specialized approaches. Key issues include low expression levels, protein misfolding, aggregation, and difficulty in extracting functional protein from membranes. A systematic troubleshooting approach involves testing multiple expression constructs with varying fusion tags (His, MBP, SUMO) and optimization of expression conditions (temperature, inducer concentration, expression duration). Screening a panel of detergents is critical, starting with mild options like DDM, LMNG, or GDN for extraction. Purification should employ multi-step protocols combining affinity chromatography with size exclusion to separate monomeric protein from aggregates. For particularly difficult constructs, expression in insect or mammalian cells may provide better folding environments. Functional validation at each purification step using limited proteolysis or thermal shift assays can identify properly folded material. Finally, co-expression with ArnF may improve stability by allowing complex formation during translation.

How can researchers effectively validate the specificity of ArnE-substrate interactions?

Validating the specificity of ArnE-substrate interactions requires multiple complementary approaches. In vitro binding assays using purified components should examine interaction with both natural substrate (undecaprenyl phosphate-α-L-Ara4N) and structural analogs to establish specificity parameters. Competition assays with varying concentrations of unlabeled substrate can determine binding affinity constants. Mutagenesis of predicted substrate-binding residues based on homology modeling or structural data should correlate with altered binding properties. In vivo approaches could include metabolic labeling with modified substrate analogs containing photoactivatable crosslinkers to capture transient enzyme-substrate complexes. Mass spectrometry techniques like hydrogen-deuterium exchange can map conformational changes upon substrate binding. For system-level validation, metabolomic profiling of cells expressing wild-type versus mutant ArnE can identify accumulation of pathway intermediates when flippase function is compromised, providing definitive evidence of substrate specificity in the cellular context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.