Recombinant Sodalis glossinidius Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Description

Overview of Sodalis glossinidius

Sodalis glossinidius is a maternally transmitted endosymbiont of tsetse flies (Glossina spp.), insects of medical and veterinary importance . It resides both intra- and extracellularly, mainly in the host's midgut, but can also be found in hemolymph . This bacterium has been implicated in enhancing the trypanosome susceptibility of tsetse flies . Sodalis infections correlate with greater symbiont densities in parasite-infected populations .

Genomic Characteristics of Sodalis glossinidius

The genome of Sodalis glossinidius exhibits significant reduction and adaptation . Its chromosome, which consists of 4,171,146 base pairs, encodes 2,432 protein-coding sequences, indicating a reduced coding capacity of 51% . The genome also contains a high number of pseudogenes, totaling 972, which is unusually high compared to other bacterial species . These pseudogenes are often homologs of proteins involved in defense, transport, and the metabolism of carbohydrates and inorganic ions, suggesting adaptations to the host's immunity and restricted nutritional environment .

Role of MdtI in Spermidine Excretion

MdtI is a component of the MdtJI complex, which plays a crucial role in spermidine excretion in Escherichia coli . Polyamines like putrescine, spermidine, and spermine are vital for cell growth, and their levels are controlled through biosynthesis, degradation, uptake, and excretion . The MdtJI complex catalyzes the excretion of spermidine from cells, preventing its overaccumulation . Both MdtJ and MdtI are necessary for recovery from spermidine toxicity .

MdtJI Complex and Spermidine Transport

The MdtJI complex influences spermidine content and excretion . Spermidine overaccumulation, but not putrescine, is observed in E. coli cells cultured with spermidine . Introducing mdtJI diminishes spermidine accumulation and enhances cell viability . Excretion of spermidine is observed in cells transformed with pUC mdtJI, confirming that the MdtJI complex facilitates spermidine excretion .

Functional Residues in MdtJI

Specific amino acid residues in MdtJ and MdtI are crucial for the excretion activity of the MdtJI complex . These residues include:

  • MdtJ: Tyr 4, Trp 5, Glu 15, Tyr 45, Tyr 61, and Glu 82

  • MdtI: Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81

Sodalis glossinidius as a Delivery System

Recombinant Sodalis has the ability to deliver functional anti-trypanosome nanobodies in different tsetse fly tissues . Engineered Sodalis can express and release significant amounts of functional anti-trypanosome nanobodies in tsetse fly tissues . This symbiont can be genetically engineered to express and release functional anti-trypanosome nanobodies in different tissues of the tsetse fly .

Type-III Secretion Systems (TTSS) in Sodalis glossinidius

Sodalis glossinidius maintains two phylogenetically distinct type-III secretion systems (TTSS) encoded by chromosomal symbiosis regions SSR-1 and SSR-2 . SSR-2 exhibits degenerative adaptations, lacking homologs of genes found in SSR-1 that encode secreted effector proteins necessary for host cell cytoskeletal rearrangements . SSR-1 is required for bacterial invasion of host cells, while SSR-2 is essential for bacterial proliferation after entry .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
mdtI; SG0629; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
mdtI
Target Protein Sequence
MQQFDLYHSGFLASAVVLEILANILLKMSDGFRKLWLGLLSLLAVLGAFSALSQAVKGID LSVAYALWGGFGIAATIAAGWIMFNQRLSSRGWAGLVLLLIGMLVIKLA
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links

KEGG: sgl:SG0629

Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Sodalis glossinidius and why is MdtI protein significant in this organism?

    Sodalis glossinidius is a maternally transmitted secondary endosymbiont residing intracellularly in tissues of tsetse flies (Glossina spp.) . This bacterium establishes a chronic, stable association characterized by both vertical (maternal) and horizontal (paternal) modes of transmission . The spermidine export protein MdtI is significant because it functions as part of a heterodimeric transporter complex (with MdtJ) involved in polyamine homeostasis, which is essential for normal cellular function. In symbiotic bacteria like Sodalis, maintaining proper polyamine levels is crucial for establishing and maintaining the host-symbiont relationship. This protein has gained research interest due to the potential applications of Sodalis in paratransgenesis approaches aimed at reducing Trypanosoma transmission by tsetse flies .

  • How does the MdtJI complex contribute to polyamine homeostasis?

    The MdtJI complex plays a critical role in maintaining polyamine homeostasis through the following mechanisms:

    • It functions specifically as a spermidine exporter, actively transporting excess spermidine out of the bacterial cell

    • Unlike other polyamine transporters that function primarily at acidic pH, the MdtJI complex effectively exports spermidine at neutral pH

    • When both MdtI and MdtJ are present, the Sec translocon appears to affect the topology of one or both proteins, resulting in proper assembly of a functional heterodimer that can be integrated into the membrane

    • The expression of mdtJI mRNA is increased in response to elevated spermidine levels, suggesting a regulatory feedback mechanism

    In experimental studies, when the MdtJI complex was expressed in E. coli CAG2242 (a strain deficient in spermidine acetyltransferase), it protected cells from spermidine toxicity by reducing intracellular spermidine accumulation and enhancing spermidine excretion .

  • What methods are used to produce recombinant Sodalis glossinidius MdtI protein?

    Recombinant Sodalis glossinidius MdtI protein is typically produced using the following methodological approach:

    • The gene encoding MdtI is cloned into an appropriate expression vector, often with an N-terminal His-tag for purification purposes

    • The construct is transformed into an E. coli expression system, which serves as a host for protein production

    • Expression is induced under controlled conditions to optimize protein yield

    • The recombinant protein is purified using affinity chromatography (taking advantage of the His-tag)

    • The purified protein is typically stored in a Tris/PBS-based buffer with trehalose or glycerol to maintain stability

    For optimal storage, the protein is generally stored at -20°C/-80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles. For working solutions, the lyophilized protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • What is the relationship between MdtI and MdtJ proteins?

    The relationship between MdtI and MdtJ proteins is characterized by:

    • They function as obligate heterodimeric partners in forming a functional spermidine export complex

    • Neither protein alone can effectively export spermidine or get properly integrated into the membrane

    • When both MdtI and MdtJ are present, they form a complex that can be properly integrated into the membrane via the Sec translocon

    • In experimental studies, expression of either MdtI or MdtJ alone did not significantly increase cell viability in the presence of excess spermidine, whereas co-expression of both proteins provided significant protection

    • Both genes (mdtI and mdtJ) are coexpressed and share significant sequence homology

    The amino acid sequence of MdtJ (126 amino acids) differs from MdtI, with key residues that have been identified as essential for the export activity, including Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 in MdtJ and Glu5, Glu19, Asp60, Trp68, and Trp81 in MdtI .

Advanced Research Questions

  • What experimental approaches can be used to study MdtI functionality and the MdtJI complex in vitro?

    Several sophisticated experimental approaches can be employed to study MdtI functionality:

    a) Spermidine excretion assays:

    • Measuring [14C]spermidine excretion from cells expressing MdtJI versus control cells

    • Quantifying spermidine levels in cell culture supernatants using HPLC or mass spectrometry

    • Using polyamine-deficient bacteria (like E. coli CAG2242) to examine rescue effects when MdtJI is expressed

    b) Site-directed mutagenesis:

    • Systematic mutation of key residues to identify those critical for function

    • Studies have identified critical residues in both MdtI (Glu5, Glu19, Asp60, Trp68, Trp81) and MdtJ (Tyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82)

    c) Membrane integration studies:

    • Reconstituting the Sec translocon inside cell-sized liposomes to study membrane integration

    • Fluorescence-based assays to detect membrane integration of MdtI/MdtJ complexes

    d) Expression analysis:

    • RT-qPCR to measure changes in mdtJI mRNA levels in response to varying spermidine concentrations

    • Western blotting to detect protein expression levels under different conditions

    A comprehensive experimental approach would combine these methods to validate findings and provide deeper mechanistic insights into MdtI function.

  • How can genetic modification techniques be applied to study MdtI in Sodalis glossinidius?

    Genetic modification of Sodalis glossinidius to study MdtI function can be achieved through several approaches:

    a) Conjugal DNA transfer:

    • Sodalis is amenable to DNA uptake by conjugation, which can be used for both forward and reverse genetic experiments

    • This involves using a donor strain (typically E. coli) carrying the desired genetic construct that can be transferred to Sodalis

    • The protocol typically includes:

      1. Construction of appropriate vectors containing genes of interest

      2. Establishing optimal growth conditions for both donor and recipient strains

      3. Mixing donor and recipient cells and allowing conjugation to occur

      4. Selection of transconjugants using appropriate antibiotics

    b) Transposon mutagenesis:

    • Previously used successfully in Sodalis to create mutants with specific phenotypes

    • MiniTn5 suicide vectors can be used to generate mutants with random insertions

    • A selection procedure can be employed to identify specific mutants of interest

    c) Homologous recombination:

    • Can be used to create targeted gene knockouts or modifications

    • Requires designing constructs with homology to the target region in the Sodalis genome

    These approaches can be used to create mdtI knockout mutants, introduce modified versions of mdtI, or create reporter fusions to study expression patterns in various conditions.

  • What is the evolutionary significance of MdtI and how does it relate to Sodalis glossinidius's symbiotic lifestyle?

    The evolutionary significance of MdtI in Sodalis glossinidius's symbiotic lifestyle can be examined from several perspectives:

    a) Phylogenetic context:

    • Phylogenetic reconstructions based on inv/spa genes of Sodalis and other members of the Enterobacteriaceae family have consistently identified a well-supported clade containing Sodalis and the enteric pathogens Shigella and Salmonella

    • This suggests that Sodalis may have evolved from an ancestor with a parasitic intracellular lifestyle, possibly a latter-day entomopathogen

    b) Evolutionary transition:

    • Research supports a hypothesis suggesting that vertically transmitted mutualistic endosymbionts like Sodalis evolve from horizontally transmitted parasites through a parasitism-mutualism continuum

    • MdtI's role in polyamine homeostasis may have been important during this evolutionary transition

    c) Functional adaptation:

    • Polyamine transport systems, including MdtI, might have been maintained during genome reduction because of their importance in establishing and maintaining the symbiotic relationship

    • Maintaining proper polyamine levels could be critical for symbiont persistence within host cells

    d) Comparative analysis:

    • Comparing MdtI sequences and functions across different Sodalis species and related bacteria could provide insights into the protein's role in symbiosis

    • Examining whether MdtI has undergone adaptive evolution specific to the tsetse fly environment could reveal specialized functions

    Understanding the evolutionary trajectory of MdtI contributes to our broader knowledge of how bacterial symbionts adapt to their hosts at the molecular level.

  • How can the MdtI/MdtJ complex be leveraged for paratransgenesis applications in tsetse flies?

    The MdtI/MdtJ complex offers several avenues for paratransgenesis applications in tsetse flies to control Trypanosoma transmission:

    a) Polyamine modulation strategy:

    • Engineering Sodalis to overexpress MdtI/MdtJ to alter polyamine levels in the tsetse fly microenvironment

    • Polyamines like spermidine affect trypanosome development and survival, potentially creating conditions unfavorable for the parasite

    b) Expression platform for anti-trypanosomal molecules:

    • MdtI/MdtJ promoters could be utilized to drive expression of anti-trypanosomal molecules

    • The natural regulation of mdtJI by polyamine levels could provide conditional expression systems

    c) Chimeric protein approach:

    • Creating fusion proteins combining MdtI/MdtJ with anti-trypanosomal peptides

    • These could potentially export anti-trypanosomal compounds when expressed in engineered Sodalis

    d) Implementation methodology:

    1. Engineer Sodalis strains using conjugation-based methods

    2. Test engineered strains in vitro for spermidine export function and expression of anti-trypanosomal factors

    3. Introduce engineered Sodalis into tsetse flies through microinjection

    4. Assess vertical transmission efficiency of the modified symbiont

    5. Evaluate impact on trypanosome infection rates and development

    This approach leverages the natural symbiosis between Sodalis and tsetse flies, potentially offering a sustainable method for reducing trypanosome transmission.

  • What are the key methodological challenges in studying MdtI transport kinetics and how can they be addressed?

    Studying MdtI transport kinetics presents several methodological challenges that can be addressed using specialized approaches:

    a) Membrane protein reconstitution challenges:

    • Challenge: MdtI requires proper membrane integration and partnership with MdtJ

    • Solution: Use of the Sec translocon reconstituted in liposomes has been shown to increase the amount and activity of membrane proteins by approximately three-fold

    • Method: Incorporate the Sec translocon into cell-sized liposomes before attempting to integrate MdtI/MdtJ

    b) Measuring transport activity directly:

    • Challenge: Direct measurement of transport requires sensitive detection methods

    • Solution:

      1. Use radioisotope-labeled spermidine ([14C]spermidine) to track transport

      2. Employ fluorescently labeled polyamine analogs

      3. Develop real-time monitoring systems using biosensors

    c) Distinguishing between MdtI contribution and other transporters:

    • Challenge: Cellular systems often have multiple transporters with overlapping functions

    • Solution:

      1. Use purified MdtI/MdtJ reconstituted in proteoliposomes

      2. Employ knockout strains lacking other transporters

      3. Conduct studies in heterologous expression systems

    d) Quantifying kinetic parameters accurately:

    • Challenge: Traditional methods may not be sensitive enough for accurate kinetic measurements

    • Solution:

      1. Develop high-throughput microfluidic systems for rapid measurement

      2. Use mass spectrometry-based approaches for precise quantification

      3. Implement computational modeling to complement experimental data

    These methodological approaches can provide deeper insights into the transport mechanism and kinetics of the MdtI/MdtJ complex.

  • What insights do structure-function studies provide about critical residues and domains in MdtI protein?

    Structure-function studies have revealed several critical insights about MdtI:

    a) Key functional residues:

    • Mutagenesis studies have identified critical residues in MdtI involved in spermidine export activity, including Glu5, Glu19, Asp60, Trp68, and Trp81

    • These residues likely play roles in substrate recognition, binding, or the transport mechanism itself

    b) Transmembrane topology:

    • MdtI contains multiple transmembrane domains characteristic of the SMR family

    • The proper topology of MdtI appears to be dependent on its interaction with MdtJ and is affected by the Sec translocon

    c) Heterodimer formation:

    • Structure-function studies suggest that MdtI and MdtJ interact to form a functional heterodimer

    • This interaction is essential for proper membrane integration and transport activity

    d) Domain organization:

    • The specific domains involved in spermidine binding versus transport have been partially characterized

    • Acidic residues (Glu, Asp) appear to be particularly important, possibly for interaction with the positively charged polyamine substrate

    e) Methodological approaches for structure-function studies:

    1. Site-directed mutagenesis targeting conserved or charged residues

    2. Domain swapping experiments between MdtI and related transporters

    3. Structural modeling based on related proteins with known structures

    4. Using computational tools like density functional theory (DFT) to analyze binding mechanisms

    These structure-function insights provide a foundation for rational engineering of MdtI for various biotechnological applications.

Technical Research Questions

  • What are the optimal expression conditions for producing functional recombinant Sodalis glossinidius MdtI protein?

    Optimizing expression conditions for functional recombinant Sodalis glossinidius MdtI protein requires consideration of several parameters:

    ParameterOptimal ConditionsJustification
    Expression SystemE. coliMost widely used for MdtI, provides good yield
    Expression VectorpET series with T7 promoterAllows controlled induction and high expression
    Fusion TagsN-terminal His-tagFacilitates purification without affecting function
    Induction Conditions0.1-0.5 mM IPTG, 16-25°CLower temperatures reduce inclusion body formation
    Growth MediumRich media (like LB)Provides necessary nutrients for membrane protein expression
    Incubation Time16-24 hours post-inductionAllows sufficient time for proper folding
    Cell Lysis MethodGentle mechanical disruptionPreserves membrane protein integrity
    Membrane SolubilizationMild detergents (DDM, LDAO)Maintains native protein conformation

    For co-expression with MdtJ (recommended for functional studies):

    1. Use a dual-expression vector containing both mdtI and mdtJ in an operon configuration

    2. Alternatively, use compatible plasmids with different antibiotic markers

    3. Balance expression levels of both proteins for optimal complex formation

    Including the Sec translocon components during expression can significantly improve the functional integration of MdtI/MdtJ into membranes, increasing activity approximately three-fold .

  • How can researchers develop and validate assays for measuring MdtI-mediated spermidine export activity?

    Developing robust assays for MdtI-mediated spermidine export involves multiple methodological approaches:

    a) Cell-based functional assays:

    • Cell viability assay: Utilize spermidine acetyltransferase-deficient strains (e.g., E. coli CAG2242) where cell viability correlates with spermidine export capacity

    • Growth inhibition assay: Measure growth recovery in the presence of high spermidine concentrations (12 mM) when MdtI/MdtJ is expressed

    • Protocol validation: Include appropriate controls (vector only, single protein expression) and dose-response relationships

    b) Direct measurement of spermidine transport:

    • Radioisotope method:

      1. Preload cells with [14C]spermidine

      2. Measure appearance of radioactivity in the extracellular medium over time

      3. Calculate export rates based on linear phase of transport

    • HPLC-based method:

      1. Collect media samples at defined time points

      2. Derivatize polyamines for detection

      3. Quantify using HPLC with fluorescence or UV detection

    c) Proteoliposome-based assays:

    • Reconstitute purified MdtI/MdtJ in proteoliposomes

    • Load liposomes with fluorescently labeled spermidine analogs

    • Measure efflux using fluorescence spectroscopy

    d) Validation criteria:

    • Substrate specificity (test various polyamines)

    • Transport kinetics (Km, Vmax determination)

    • Inhibitor sensitivity

    • pH dependence

    • Requirement for both MdtI and MdtJ

    The cell viability assay provides a convenient initial screening method, while direct measurement of spermidine transport offers more quantitative kinetic information.

  • What comparative genomic approaches can elucidate the evolution and distribution of MdtI among different Sodalis species and related bacteria?

    Comparative genomic approaches to study MdtI evolution and distribution include:

    a) Sequence-based phylogenetic analysis:

    • Collect MdtI homolog sequences from diverse bacterial species

    • Perform multiple sequence alignment using MUSCLE or MAFFT

    • Construct phylogenetic trees using maximum likelihood or Bayesian methods

    • Compare MdtI phylogeny with species phylogeny to identify potential horizontal gene transfer events

    b) Synteny analysis:

    • Examine genomic context of mdtI across different species

    • Identify conservation of gene neighborhoods and operon structures

    • Compare with mdtJ to determine if they have co-evolved

    c) Selection pressure analysis:

    • Calculate dN/dS ratios to identify sites under positive selection

    • Compare selection patterns between free-living bacteria and endosymbionts

    • Identify adaptation signatures specific to the tsetse fly environment

    d) Methodological workflow:

    1. Genome mining using BLAST or HMM profiles to identify MdtI homologs

    2. Functional annotation of identified sequences

    3. Structural prediction and comparison

    4. Evolutionary rate analysis

    5. Correlation with bacterial lifestyle (free-living, facultative symbiont, obligate symbiont)

    e) Resources and tools:

    • Genomic databases: NCBI GenBank, JGI IMG, EnsemblBacteria

    • Analysis software: MEGA, MrBayes, RAxML, PAML

    • Visualization tools: Geneious, Artemis, UGENE

    This comparative approach can reveal how MdtI has evolved during the transition from free-living to symbiotic lifestyles, providing insights into its role in symbiosis.

  • What strategies can be employed to investigate the interaction interface between MdtI and MdtJ proteins?

    Multiple complementary strategies can be employed to investigate the MdtI-MdtJ interaction interface:

    a) Crosslinking-based approaches:

    • Chemical crosslinking followed by mass spectrometry (XL-MS)

    • Photo-affinity labeling with UV-activatable crosslinkers

    • These methods can identify residues in close proximity at the interface

    b) Mutagenesis strategies:

    • Alanine scanning mutagenesis of predicted interface residues

    • Charge reversal mutations to disrupt ionic interactions

    • Cysteine scanning mutagenesis followed by disulfide crosslinking

    c) Structural biology techniques:

    • X-ray crystallography of the purified complex

    • Cryo-electron microscopy for membrane protein structure determination

    • NMR spectroscopy for identifying dynamic interactions

    d) Computational approaches:

    • Molecular docking simulations

    • Molecular dynamics simulations to study the stability of predicted interfaces

    • Coevolution analysis to identify co-varying residue pairs

    e) Methodological protocol example: Disulfide crosslinking approach

    1. Perform sequence analysis and structural modeling to predict interface regions

    2. Generate cysteine substitutions at predicted interface residues

    3. Express mutant proteins and analyze formation of disulfide bonds

    4. Validate functional consequences of interface mutations

    5. Map the interaction surface based on crosslinking efficiency

    f) Biophysical characterization:

    • Microscale thermophoresis or isothermal titration calorimetry to measure binding affinities

    • Fluorescence resonance energy transfer (FRET) to assess proximity in living cells

    Combining these approaches can provide a comprehensive understanding of the MdtI-MdtJ interaction interface, essential for understanding complex formation and function.

  • How can genetic interaction mapping be utilized to understand the functional network of MdtI in bacterial systems?

    Genetic interaction mapping provides powerful insights into the functional network of MdtI:

    a) E. coli Synthetic Genetic Array (eSGA) approach:

    • This methodology creates double mutants by systematically combining an mdtI mutation with mutations in other genes

    • The growth phenotypes of double mutants are compared to single mutants to identify genetic interactions

    • Protocol steps include:

      1. Construction of donor strains carrying mdtI mutation

      2. Conjugation with recipient array of single mutants

      3. Selection of double mutants

      4. Quantitative scoring of colony sizes

      5. Statistical analysis to identify significant interactions

    b) Types of genetic interactions that can be identified:

    • Aggravating (negative) interactions: When double mutants grow worse than expected

    • Alleviating (positive) interactions: When double mutants grow better than expected

    • These patterns reveal functional relationships between genes

    c) Data analysis and network construction:

    • Generate interaction scores based on colony size measurements

    • Construct genetic interaction networks

    • Identify functional modules associated with MdtI

    d) Integration with other data types:

    • Combine genetic interaction data with:

      1. Protein-protein interaction data

      2. Co-expression networks

      3. Metabolic pathway information

    • This integration can provide a comprehensive functional map

    e) Application to understudied organisms like Sodalis:

    • Develop conjugation-based methods similar to those established for E. coli

    • Use transposon mutagenesis to create recipient arrays

    • Implement selection systems appropriate for Sodalis

    Genetic interaction mapping can reveal unexpected connections between MdtI and other cellular processes, providing insights into its broader functional role beyond polyamine transport.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.