Recombinant Sodalis glossinidius Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
arnC; SG1844; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-326
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
arnC
Target Protein Sequence
MTTPMKIDKVSIVIPVYNEQESLPELMRRTVAACEQLDAAYEILLVDDGSSDDSAAVLTA AAEAPGSHIVAVLLNRNYGQHSAIMAGFSHVTGDLVVTLDADLQNPPEEIPRLVEVAAQD YDVVGTVRQNRQDSWFRKRASRMINALIQRTTGKAMGDYGCMLRAYRRHIIDAMLHCHER STFIPILANTFARKTIEIPVMHSEREFGDSKYSLMKLVNLMYDLVTCLTTTPLRMLSVIG SMIALLGFAFSLLLITLRLFLGSHWAAEGVFMLFAVLFIFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQCVVSQNPLSSQQETQ
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links

KEGG: sgl:SG1844

STRING: 343509.SG1844

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of arnC in bacterial systems and why is it significant for research?

ArnC functions as an integral membrane glycosyltransferase that attaches a formylated form of aminoarabinose (L-Ara4FN) to undecaprenyl phosphate (UndP), enabling its association with the bacterial inner membrane . This modification is critical in Gram-negative bacteria as it contributes to resistance against polymyxin antibiotics and cationic antimicrobial peptides by ultimately leading to modification of Lipid A with aminoarabinose . The significance of studying arnC from Sodalis glossinidius lies in understanding both bacterial resistance mechanisms and symbiotic relationships, as S. glossinidius is a secondary endosymbiont of tsetse flies that may influence vector competence for trypanosomes .

How does arnC fit into the Lipid A modification pathway?

ArnC operates within a multi-enzyme pathway that modifies Lipid A with aminoarabinose. In this pathway:

  • ArnC attaches 4-deoxy-4-formamido-L-arabinose to undecaprenyl phosphate

  • The resulting UndP-Ara4FN serves as a membrane-associated carrier for the modified sugar

  • ArnD subsequently deformylates UndP-Ara4FN to produce UndP-Ara4N

  • Finally, ArnT transfers the Ara4N moiety to Lipid A

This sequential process ultimately reduces the negative charge of the bacterial outer membrane, decreasing its affinity for cationic antimicrobial compounds . The pathway is particularly important in understanding mechanisms of polymyxin resistance, which is a significant clinical concern.

What is the taxonomic position of Sodalis glossinidius and how does this influence arnC research?

Sodalis glossinidius has the following taxonomic classification:

  • Domain: Bacteria

  • Phylum: Pseudomonadota

  • Class: Gammaproteobacteria

  • Order: Enterobacterales

  • Family: Pectobacteriaceae

  • Genus: Sodalis

  • Species: S. glossinidius

This taxonomic position is significant because S. glossinidius is the only gammaproteobacterial insect symbiont that can be cultured in laboratory conditions, making it amenable to genetic modification and experimental manipulation . This unique characteristic provides researchers with opportunities to study arnC in its native context and potentially manipulate it for vector control strategies targeting tsetse flies, which are vectors of African trypanosomiasis .

What structural features define arnC and how do they contribute to its function?

Recent cryo-electron microscopy studies of arnC from Salmonella enterica (a homolog of S. glossinidius arnC) reveal three main structural elements:

  • A glycosyltransferase type A (GT-A) domain containing the catalytic site

  • A transmembrane domain (TMD) that anchors the protein in the bacterial inner membrane

  • Juxtamembrane (JM) helices that connect the GT-A domain to the TMD

The protein forms a tetrameric arrangement with each protomer containing these structural elements. The juxtamembrane helices are particularly important as they create a channel through which the lipid substrate (undecaprenyl phosphate) can thread to reach the active site in the GT-A domain . The GT-A domain contains a DXD motif characteristic of metal-dependent glycosyltransferases, with the first aspartate likely functioning as a catalytic base to abstract a proton from UndP, activating it for nucleophilic attack .

How does metal coordination affect arnC enzyme activity?

Metal coordination is crucial for arnC function, with Mn²⁺ playing a key role in substrate binding and catalysis. Microscale thermophoresis (MST) experiments have shown that Mn²⁺ enables higher affinity binding of the partial donor substrate UDP . The metal ion is coordinated by:

  • The second aspartate residue in the conserved DXD motif

  • Coordinating residues in the enzyme's active site

  • Oxygen atoms from the phosphate groups of the UDP substrate

This coordination stabilizes the leaving group (UDP) during the glycosyl transfer reaction and positions the donor substrate for nucleophilic attack by the acceptor phosphate of UndP . Researchers studying arnC activity should therefore include appropriate divalent cations (preferably Mn²⁺) in their experimental buffer systems.

What conformational changes occur in arnC upon substrate binding?

Comparison of the apo and UDP-bound conformations of arnC reveals a significant conformational rearrangement triggered by UDP binding:

  • UDP binding induces a clamshell-like motion

  • This movement brings the GT-A domain closer to the juxtamembrane helices

  • The previously unresolved A-loop becomes ordered upon UDP binding

  • This conformational change likely facilitates proper positioning of both substrates for catalysis

This conformational flexibility is essential for the catalytic cycle, allowing the enzyme to accommodate both the nucleotide-sugar donor and the lipid acceptor substrates in the active site. Understanding these conformational dynamics is crucial for structure-based drug design targeting arnC.

What are the optimal conditions for expressing and purifying recombinant S. glossinidius arnC?

Based on protocols used for homologous proteins, the following methodology is recommended:

Expression system:

  • E. coli expression system (typically BL21(DE3) or equivalent)

  • Expression vector containing N-terminal 6x-His tag

  • Induction with IPTG at lower temperatures (16-18°C) to improve membrane protein folding

Purification protocol:

  • Cell lysis in buffer containing 50 mM Na phosphate pH 7.6, 300 mM NaCl, 5% glycerol, 0.5 mM TCEP

  • Membrane solubilization with 1% DDM (dodecyl maltoside)

  • IMAC purification using Ni-NTA resin

  • Elution with 300 mM imidazole

  • Optional TEV protease cleavage to remove His-tag

  • Size exclusion chromatography using Superdex 200 column

For enhanced stability, reconstitution into nanodiscs or stabilization with amphipols (such as A8-35) is recommended for structural studies .

How can researchers assess the enzymatic activity of arnC in vitro?

The enzymatic activity of arnC can be assessed using the following methods:

Transferase assay with fluorescent substrate:

  • Prepare reaction buffer: 50 mM HEPES pH 7.0, 100 mM NaCl, 5 mM MnCl₂

  • Use 2CN-BP (fluorescent analog of undecaprenyl phosphate) as acceptor substrate

  • Use UDP-Ara4FN as donor substrate

  • Monitor formation of 2CN-BP-Ara4N by HPLC with fluorescence detection

Transferase assay with native substrates:

  • Extract native undecaprenyl phosphate from bacterial membranes

  • Incubate with purified arnC and UDP-Ara4FN

  • Extract lipids with n-butanol

  • Analyze products using ESI-LC-MS in negative ion mode

  • Monitor for the formation of BP-Ara4N

Control reactions should include enzyme-free samples and samples lacking either the donor or acceptor substrate.

What techniques are most effective for studying the structural dynamics of arnC?

Several complementary techniques can be employed to study arnC structural dynamics:

Cryo-electron microscopy:

  • Most effective for determining high-resolution structures

  • Can capture different conformational states (apo vs. substrate-bound)

  • Resolution of 2.75 Å has been achieved for apo state and 3.8 Å for UDP-bound state

Molecular dynamics simulations:

  • Coarse-grained simulations to investigate lipid interactions

  • Atomistic simulations to study substrate coordination

  • Can reveal coordination positions for UndP within the GT-A domain

  • Useful for proposing catalytic mechanisms

Microscale thermophoresis:

  • Effective for measuring binding affinities

  • Can determine the effect of metal ions on substrate binding

  • Enables characterization of substrate-enzyme interactions

Hydrogen-deuterium exchange mass spectrometry:

  • Useful for mapping conformational changes upon substrate binding

  • Can identify regions with altered solvent accessibility

  • Complements static structural data with dynamic information

How does arnC contribute to polymyxin resistance mechanisms?

ArnC plays a critical role in polymyxin resistance through the following mechanism:

  • ArnC catalyzes the attachment of Ara4FN to undecaprenyl phosphate

  • This is a key step in the pathway leading to Lipid A modification with aminoarabinose

  • The addition of aminoarabinose to Lipid A reduces the negative charge of the bacterial outer membrane

  • This charge reduction decreases the binding affinity of cationic antimicrobial peptides, including polymyxins

  • The result is increased bacterial survival in the presence of these antimicrobials

Research has shown that disruption of the arnC gene can lead to increased susceptibility to polymyxins, making it a potential target for combating antimicrobial resistance. Understanding the structural basis of arnC function provides opportunities for developing inhibitors that could restore polymyxin sensitivity in resistant bacteria .

What approaches can be used to target arnC for development of antimicrobial adjuvants?

Several approaches can be considered for targeting arnC:

Structure-based inhibitor design:

  • Utilize the recently determined cryo-EM structures to design compounds that bind to the active site

  • Target the UDP-binding pocket with nucleotide analogs

  • Design compounds that prevent the conformational change required for catalysis

  • Develop molecules that interfere with metal coordination

Substrate competition:

  • Design UndP analogs that compete for binding but cannot participate in the transfer reaction

  • Develop UDP-Ara4FN analogs that bind but inhibit the catalytic process

Allosteric inhibition:

  • Target cavity 2 identified in structural studies

  • Develop compounds that disrupt the tetrameric arrangement of the enzyme

  • Design molecules that prevent the clamshell motion necessary for catalysis

Such inhibitors would not directly kill bacteria but could function as adjuvants to restore effectiveness of polymyxins against resistant strains.

How can mutations in arnC affect bacterial susceptibility to antimicrobial peptides?

Mutations in arnC can impact bacterial susceptibility to antimicrobial peptides in several ways:

Loss-of-function mutations:

  • Complete inactivation typically increases susceptibility to polymyxins and other cationic antimicrobial peptides

  • In a Tn5 mutagenesis study, integration into the arnC homolog in S. glossinidius rendered the bacterium incapable of invading insect cells

Catalytic site mutations:

  • Mutations in the DXD motif can reduce enzyme efficiency

  • Alterations of metal-coordinating residues can disrupt the catalytic mechanism

  • Modifications to substrate-binding residues can affect affinity for UDP-Ara4FN or UndP

Regulatory mutations:

  • Changes in expression levels of arnC can affect the amount of modified Lipid A

  • Mutations in regulatory regions can alter the response to environmental signals that normally induce the Arn pathway

Characterizing natural and laboratory-induced mutations in arnC provides insights into resistance mechanisms and potential vulnerability points for therapeutic intervention.

How does arnC from Sodalis glossinidius compare to homologs in pathogenic bacteria?

Comparative analysis reveals important similarities and differences:

FeatureS. glossinidius arnCPathogenic bacteria (e.g., S. enterica) arnC
Sequence identityReferenceHigh conservation in catalytic domains (>70%)
ExpressionConstitutive in symbiontOften regulated by PhoPQ/PmrAB systems in pathogens
Genomic contextMay show gene erosionTypically within intact operon structures
FunctionMay influence host-symbiont interactionsCritical for antimicrobial resistance
Substrate specificityPotentially adapted to symbiotic lifestyleOptimized for pathogen survival

The arnC from S. glossinidius shares the core catalytic mechanism with pathogenic homologs, but may have evolved specific adaptations for its symbiotic lifestyle. The prevalence of S. glossinidius in tsetse populations is relatively low (0.88% in some studies) , suggesting that arnC may have additional or modified functions in this symbiotic context compared to pathogenic bacteria.

How can molecular dynamics simulations enhance our understanding of arnC function?

Molecular dynamics simulations offer several advantages for arnC research:

  • Substrate binding pathway elucidation:

    • Coarse-grained simulations have revealed how UndP threads between juxtamembrane helices

    • Simulations showed UndP binding time of ~8 µs, indicating stable interaction

  • Active site dynamics:

    • Atomistic simulations have identified two different coordination positions for UndP:

      • Position P1: "standby" position

      • Position P2: "catalysis" position that enables nucleophilic attack

  • Catalytic mechanism insights:

    • Simulations suggest the first aspartate of the DXD motif functions as a catalytic base

    • This allows for abstraction of a proton from UndP, activating it for nucleophilic attack

  • Lipid interactions:

    • Simulations with the LipIDens pipeline have identified cardiolipin binding sites on the periplasmic face

    • Revealed potential annular lipid interactions that stabilize the protein in the membrane

These computational approaches complement experimental studies and provide atomic-level details difficult to obtain through experimental methods alone.

What potential exists for engineering Sodalis glossinidius arnC for vector control strategies?

The unique characteristics of S. glossinidius offer several opportunities for vector control:

  • Paratransgenic approach:

    • S. glossinidius is the only culturable gammaproteobacterial insect symbiont

    • This makes it amenable to genetic modification for reintroduction into tsetse flies

    • Modified arnC could potentially alter tsetse susceptibility to trypanosomes

  • Modification strategies:

    • Engineering arnC to produce modified cell surface molecules that interfere with trypanosome development

    • Creating conditional lethal systems linked to arnC function

    • Developing strains with modified arnC that reduce vector competence

  • Implementation considerations:

    • The low prevalence of S. glossinidius in wild tsetse populations (0.88-11.20%) may limit effectiveness

    • Strategies may need to include mechanisms to increase symbiont prevalence

    • Release methods would need to ensure modified bacteria can establish in fly populations

  • Research needs:

    • Better understanding of the relationship between S. glossinidius and trypanosome establishment

    • Clarification of conflicting reports on association between Sodalis and trypanosome presence

    • Development of efficient transformation systems specific to S. glossinidius

This potential application represents an advanced research direction that could leverage fundamental knowledge of arnC for applied vector control strategies.

What strategies can overcome poor expression or solubility of recombinant arnC?

As an integral membrane protein, arnC presents several expression and solubility challenges. Researchers can implement these strategies:

Expression optimization:

  • Use specialized E. coli strains designed for membrane protein expression (C41, C43, Lemo21)

  • Lower induction temperature to 16-18°C and extend expression time to 16-24 hours

  • Reduce IPTG concentration to 0.1-0.5 mM to slow expression rate

  • Consider using auto-induction media to achieve gradual protein production

Solubilization approaches:

  • Screen multiple detergents beyond DDM, including LMNG, GDN, or digitonin

  • Test solubilization at different temperatures (4°C vs. room temperature)

  • Optimize detergent concentration and solubilization time

  • Consider using membrane scaffold proteins and lipid nanodiscs for improved stability

Construct optimization:

  • Test both N-terminal and C-terminal His-tags

  • Incorporate fusion partners like MBP or SUMO that can enhance solubility

  • Consider truncation constructs that preserve the catalytic domain

  • Introduce thermostabilizing mutations based on computational prediction

These approaches have been successful for structural studies of homologous proteins and can be adapted to S. glossinidius arnC.

How can researchers differentiate between enzymatic activity of arnC and potential contaminating enzymes?

Ensuring specificity of enzymatic assays is critical for accurate characterization:

  • Negative controls:

    • Use catalytically inactive arnC mutants (e.g., DXD motif mutations)

    • Perform assays with heat-inactivated enzyme

    • Include controls with mismatched substrates

  • Specific inhibition:

    • Test activity in the presence of metal chelators (EDTA)

    • Use specific inhibitors if available

    • Compare activity with and without competing substrates

  • Verification methods:

    • Confirm product identity using mass spectrometry

    • Analyze kinetic parameters to ensure they match expected values

    • Perform activity assays with increasing enzyme concentration to confirm proportionality

  • Purification verification:

    • Assess protein purity using SDS-PAGE and Western blotting

    • Perform size exclusion chromatography to confirm tetrameric state

    • Consider native PAGE to verify oligomeric status

In the study of arnC variants, researchers successfully differentiated between mutant and wild-type activities using complementation analyses with inactivated membrane fractions, demonstrating the importance of appropriate controls .

What considerations are important when studying arnC in different bacterial species?

When expanding arnC research to different bacterial species, researchers should consider:

Sequence variation:

  • Perform thorough sequence alignment to identify conservation of key catalytic residues

  • Note species-specific insertions or deletions that might affect function

  • Pay attention to differences in the DXD motif and metal-coordination sites

Expression conditions:

  • Different bacterial species may have varied optimal growth conditions

  • Consider native expression levels and regulation mechanisms

  • Evaluate the need for species-specific expression systems

Functional assessment:

  • The prevalence of S. glossinidius varies significantly between geographic locations and tsetse species (0.88-11.20%)

  • Different species may show variation in substrate specificity

  • Compare kinetic parameters between homologs to identify functional differences

Evolutionary context:

  • Consider gene erosion and pseudogene formation, which has been observed in S. glossinidius

  • Examine genomic context for insight into species-specific regulation

  • Perform phylogenetic analyses using aligned sequences to understand evolutionary relationships

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.