Recombinant Sodalis glossinidius UPF0208 membrane protein SG1605 (SG1605)

Shipped with Ice Packs
In Stock

Description

Introduction

Sodalis glossinidius is a bacterial endosymbiont that colonizes the tsetse fly (Glossina spp.), playing a role in the fly's physiology and immunity . Within S. glossinidius, SG1605 is annotated as a UPF0208 membrane protein, where UPF signifies "Uncharacterized Protein Family" . Proteins within this family lack functional annotation, and SG1605's precise biological role remains largely unknown .

General Information

Due to the limited information available regarding SG1605, information from related Sodalis glossinidius proteins is included to provide a broader context.

FeatureDescription
OrganismSodalis glossinidius (strain morsitans)
Protein TypeUPF0208 membrane protein
LocusSG1605
FunctionUnknown; part of the UPF0208 family of uncharacterized proteins
Potential RolesAs a membrane protein, SG1605 may be involved in transport processes, signal transduction, or maintaining cell structure . It could also play a role in biofilm formation, similar to other outer membrane proteins in Sodalis . Further research might reveal involvement in the symbiotic relationship between Sodalis and the tsetse fly, potentially related to nutrient exchange or immune modulation .

Structure and Features

The primary structure of SG1605 can be inferred from genomic data of Sodalis glossinidius. As a membrane protein, SG1605 is expected to possess hydrophobic regions that facilitate its integration into the bacterial cell membrane . Further research is needed to elucidate the precise structural features of this protein, including the identification of transmembrane domains and any potential post-translational modifications.

Research and Findings

  1. Determining the Expression Pattern: Analyzing when and where SG1605 is expressed within Sodalis glossinidius in different environments can give clues about its function.

  2. Structural Analysis: Using computational tools to predict the protein's structure and identify potential functional domains.

  3. Interaction Studies: Identifying other proteins that interact with SG1605 to understand its role in cellular processes.

  4. Mutational Analysis: Creating mutants lacking SG1605 to observe any resulting phenotypic changes in Sodalis, such as altered growth, colonization ability, or biofilm formation.

Potential Implications

Sodalis glossinidius has potential applications in paratransgenesis, a strategy that uses genetically modified symbiotic bacteria to express and deliver molecules that can affect the host organism . Understanding the functions of proteins like SG1605 may help in designing novel paratransgenic strategies to control tsetse fly populations or combat disease transmission.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SG1605; UPF0208 membrane protein SG1605
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
SG1605
Target Protein Sequence
MSTLPSGSVSWYKIFQRGQNYMKAWPAEKSLAPMFPEHRVVRATRFGVRFMPAVAVFTLT WQIALGGQLGPAVATAIFACSLPMQGLWWLGKRSITPLPPSLLTCFHEVRQKLNEAGQSL APVEGVPTYQMLVEVLKRAFKLLDKAFLDDL
Uniprot No.

Target Background

Database Links

KEGG: sgl:SG1605

STRING: 343509.SG1605

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.