Recombinant Sodalis glossinidius UPF0259 membrane protein SG1383 (SG1383)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Sodalis glossinidius UPF0259 Membrane Protein SG1383 (SG1383)

Recombinant Sodalis glossinidius UPF0259 membrane protein SG1383 (SG1383) is a bioengineered variant of a native membrane protein expressed by Sodalis glossinidius, a maternally inherited symbiont of tsetse flies. This protein belongs to the UPF0259 family, a group of uncharacterized proteins with conserved structural motifs. The recombinant form is produced in yeast systems and designed for research applications, including structural studies, symbiosis mechanisms, and pathogen interaction analysis .

Primary Sequence and Expression

SG1383 is a partial-length recombinant protein spanning residues 1–250 of the full-length native protein. Its amino acid sequence (Table 1) reveals hydrophobic regions and transmembrane domains, characteristic of membrane-associated proteins .

Sequence SegmentAmino Acid Sequence
N-terminalMPIMASTLYRDMLNFFRNQFASILLLALLTALISVVLGHALSPGSEQLMTLSDGTHLGDTAEMSLQQLVQQMSVEQQRVLLKASAAGTLAGLVGNVLLAGGLLTMIRQVSNRQPVSVLRAIGLSAPLLPRLLLLIFLTTLLVQLGLLLIIVPGILLAIAFSLAPVIATSDDLGAIKSMRQSSSLAFANLRLLAPAVLFWLLAKAAVLLLATQFTLVSSLVAVVLLNGLSNLISALLLIYLYRLYMLLRQA

Key Features:

  • Transmembrane Domains: Predicted alpha-helical structures in hydrophobic regions (e.g., residues 11–25: FASILLLALLTALISVVL) .

  • Functional Motifs: Potential binding sites for lipids or ions, inferred from conserved residues (e.g., arginine R50 in analogous membrane proteins) .

Product Details

ParameterSpecification
Uniprot IDQ2NT67
SpeciesSodalis glossinidius (strain morsitans)
Tag TypeDetermined during manufacturing (e.g., His-tag, GST-tag)
Purity>85% (SDS-PAGE)
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); stabilize with 5–50% glycerol

Notes:

  • Stability: Lyophilized form stable for 12 months at -20°C/-80°C; liquid form stable for 6 months .

  • Handling: Store working aliquots at 4°C for ≤1 week .

Comparative Analysis with Related Proteins

ProteinFunctionKey FeaturesCitations
SG1383UPF0259 membrane proteinPartial sequence; yeast-expressed
SG0393UPF0391 membrane proteinInvolved in metabolic/biosynthetic pathways ,
PhoPQ-regulatedOuter membrane cardiolipin regulationBinds cardiolipin via hydrophobic/ionic interactions

Insights:

  • Genetic Manipulation: Conjugation-based DNA transfer enables targeted gene disruption in S. glossinidius, facilitating studies on membrane protein roles .

  • Evolutionary Context: S. glossinidius plasmids (e.g., pSG1, pSG2) carry pseudogenes and conjugation-related genes, reflecting adaptation to tsetse hosts .

Future Research Directions

  1. Structural Elucidation: Cryo-EM or X-ray crystallography to map transmembrane topology and ligand-binding sites.

  2. Functional Screens: Assess SG1383’s role in symbiosis using CRISPRi or transposon mutagenesis .

  3. Biotechnological Applications: Explore SG1383 as a scaffold for nanobody fusion proteins to target pathogens in tsetse flies .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for the estimated delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol utilizes a 50% glycerol concentration, which can serve as a reference for your use.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
SG1383; UPF0259 membrane protein SG1383
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Sodalis glossinidius (strain morsitans)
Target Names
SG1383
Target Protein Sequence
MPIMASTLYRDMLNFFRNQFASILLLALLTALISVVLGHALSPGSEQLMTLSDGTHLGDT AEMSLQQLVQQMSVEQQRVLLKASAAGTLAGLVGNVLLAGGLLTMIRQVSNRQPVSVLRA IGLSAPLLPRLLLLIFLTTLLVQLGLLLIIVPGILLAIAFSLAPVIATSDDLGAIKSMRQ SSSLAFANLRLLAPAVLFWLLAKAAVLLLATQFTLVSSLVAVVLLNGLSNLISALLLIYL YRLYMLLRQA
Uniprot No.

Target Background

Database Links

KEGG: sgl:SG1383

STRING: 343509.SG1383

Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sodalis glossinidius and why is the SG1383 protein significant?

Sodalis glossinidius is an endosymbiotic bacterium found in tsetse flies (Glossina species). This organism has attracted significant attention in molecular biology research due to its unusual genome characteristics, particularly its high pseudogene content. The genome of Sodalis glossinidius contains almost 50% pseudogenes with mutations that potentially silence them at the genomic level, making it an exceptional model for studying genome evolution and host-microbe interactions . Despite being an endosymbiont with reduced gene density (a characteristic shared with other intracellular bacteria), Sodalis demonstrates significant expression from its putative pseudogenes .

The SG1383 protein, specifically designated as a UPF0259 membrane protein, represents one of the expressed proteins from the Sodalis genome . This protein is significant because it illustrates the active gene expression machinery within this organism, despite its high pseudogene content. Understanding the structure, function, and expression patterns of proteins like SG1383 helps researchers decipher how Sodalis maintains its symbiotic relationship with its host while undergoing apparent genome reduction.

How does SG1383 expression relate to the pseudogene phenomenon in Sodalis glossinidius?

Although the search results don't specifically address whether SG1383 itself is encoded by a functional gene or a pseudogene, the broader context of Sodalis glossinidius genome expression provides valuable insights. Research has shown that between 53% and 74% of the Sodalis transcriptome remains active even in cell-free culture conditions . The mean sense transcription from coding domain sequences (CDSs) in Sodalis is approximately four times greater than that from pseudogenes, indicating that while pseudogenes are expressed, functional genes maintain higher expression levels .

Comparative genomic analysis of six Illumina-sequenced Sodalis isolates from different host Glossina species revealed that pseudogenes comprise approximately 40% of the 2729 genes in the core genome . This consistency suggests that pseudogenes in Sodalis are stable and/or that Sodalis is a relatively recent introduction across the genus Glossina as a facultative symbiont . In this context, proteins like SG1383 that are expressed and isolated represent important elements for understanding how this organism balances gene expression between functional genes and pseudogenes.

What experimental approaches are commonly used to express and purify SG1383?

For successful expression and purification of the SG1383 protein, researchers typically employ the following methodology:

  • Expression System Selection: The recombinant SG1383 protein is commonly expressed in E. coli systems with an N-terminal His tag to facilitate purification . This approach allows for efficient production and subsequent isolation of the protein.

  • Protein Purification Protocol: After expression, the protein undergoes affinity chromatography using the His tag, resulting in preparations with purity greater than 90% as determined by SDS-PAGE .

  • Storage and Stability Considerations: The purified protein is typically stored as a lyophilized powder and reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add 5-50% glycerol (with 50% being the default final concentration) and store aliquots at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

These approaches provide a robust framework for obtaining functional SG1383 protein for various downstream analyses, including structural studies, interaction assays, and functional characterization.

How can transcriptomic and proteomic analyses be integrated to understand SG1383 expression patterns?

Understanding the expression patterns of SG1383 requires a multi-omics approach that combines transcriptomics and proteomics. Based on research with Sodalis glossinidius, the following integrated methodology is recommended:

  • Stranded RNA Sequencing: This technique allows quantification of the directionality of transcription, which is particularly important in Sodalis given its complex transcriptional landscape including pseudogenes . For SG1383, stranded RNA-seq can reveal whether there is antisense transcription occurring at this locus, which might regulate its expression.

  • Proteome Analysis: Direct protein identification and quantification through techniques such as liquid chromatography-mass spectrometry (LC-MS/MS) should be performed in parallel with transcriptomics . This approach can confirm that the SG1383 transcript is indeed translated into protein and can quantify relative abundance.

  • Data Integration: The correlation between SG1383 transcript levels and protein abundance should be analyzed across different conditions (e.g., in culture vs. in host) to understand post-transcriptional regulation mechanisms.

  • Comparative Analysis: Expression patterns of SG1383 should be compared with those of other genes/proteins within the same functional category (membrane proteins) and with pseudogenes to place its expression in the broader context of Sodalis biology .

This integrated approach provides a comprehensive view of SG1383 expression from gene to protein, facilitating understanding of its regulation and potential function in Sodalis glossinidius.

What statistical approaches are most appropriate for analyzing experimental data on SG1383 expression?

When analyzing experimental data related to SG1383 expression, appropriate statistical methodologies should be selected based on the experimental design. Following are recommended statistical approaches:

  • Analysis of Variance (ANOVA): For experiments comparing SG1383 expression across multiple conditions or treatments, ANOVA is appropriate . When designing such experiments:

    • Completely Randomized Design (CRD) is suitable when experimental material is homogeneous and for small numbers of treatments .

    • Randomized Block Design (RBD) is preferred when dealing with heterogeneous experimental material, allowing for control of variation through blocking .

    • Latin Square Design (LSD) should be considered when three factors need to be controlled simultaneously .

  • Experimental Design Considerations:

    • Clear identification of experimental units (e.g., bacterial cultures expressing SG1383) and sampling units (e.g., protein extracts) .

    • Appropriate replication to ensure statistical power .

    • Blocking where necessary to reduce experimental error .

  • Data Transformation: Expression data often requires log transformation before statistical analysis to achieve normality.

  • Multiple Testing Correction: When analyzing SG1383 expression alongside multiple other genes/proteins, appropriate corrections for multiple testing (e.g., Benjamini-Hochberg procedure) should be applied.

What approaches can be used to study potential interactions between SG1383 and host proteins?

Investigating potential interactions between the bacterial SG1383 membrane protein and host proteins (from Glossina species) is crucial for understanding its role in symbiosis. The following methodological approaches are recommended:

  • In vitro Binding Assays: Using purified recombinant SG1383 protein with the N-terminal His tag , researchers can perform pull-down assays with host cell lysates to identify potential binding partners.

  • Yeast Two-Hybrid Screening: While challenging for membrane proteins, modified yeast two-hybrid systems designed for membrane proteins can be employed to screen for host interactors.

  • Co-immunoprecipitation (Co-IP): If suitable antibodies against SG1383 can be developed, Co-IP followed by mass spectrometry can identify host proteins that form complexes with SG1383 in more native conditions.

  • Crosslinking Mass Spectrometry: Chemical crosslinking followed by mass spectrometry analysis can capture transient or weak interactions between SG1383 and host proteins.

  • Functional Assays: Following identification of potential interactions, functional validation through techniques such as:

    • Mutagenesis of interaction domains

    • Competition assays with peptides derived from interaction regions

    • In vivo studies examining phenotypic effects when interactions are disrupted

These approaches provide complementary data on SG1383-host protein interactions, contributing to understanding the molecular basis of the Sodalis-Glossina symbiotic relationship.

How does the evolutionary conservation of SG1383 across different Sodalis isolates inform functional hypotheses?

The evolutionary conservation of SG1383 across different Sodalis isolates can provide valuable insights into its functional importance. Based on comparative genomic approaches employed for Sodalis glossinidius:

  • Comparative Sequence Analysis: Examining SG1383 sequences across the six Illumina-sequenced Sodalis isolates from different host Glossina species can reveal:

    • Sequence conservation levels suggesting functional constraints

    • Potential adaptive mutations in different host backgrounds

    • Whether SG1383 belongs to the core genome (shared across isolates) or accessory genome

  • Synteny Analysis: Examining the genomic context of SG1383 across different isolates can provide insights into operon structure and potential co-regulation with neighboring genes.

  • Selection Pressure Analysis: Calculating dN/dS ratios (ratio of non-synonymous to synonymous substitutions) can determine whether SG1383 is under purifying selection (functional constraint) or positive selection (adaptive evolution).

  • Pseudogenization Assessment: Given the high rate of pseudogenization in Sodalis (approximately 40% of core genome genes are pseudogenes) , determining whether SG1383 remains a functional gene across all isolates is critical for functional hypotheses.

This evolutionary perspective on SG1383 can guide functional studies by highlighting conserved regions likely to be functionally important and identifying potential host-specific adaptations.

What experimental design is most appropriate for studying SG1383 function in vitro?

When designing experiments to investigate SG1383 function in vitro, several key experimental design principles should be considered:

  • Experimental Design Structure:

    • For comparing multiple conditions affecting SG1383 function, a Randomized Block Design (RBD) is often appropriate to control for variation between experimental batches .

    • When studying interactions between multiple factors (e.g., temperature, pH, and substrate concentration), consider factorial designs to efficiently detect interaction effects .

  • Controls and Replication:

    • Include appropriate negative controls (e.g., vector-only or irrelevant protein controls) and positive controls where possible.

    • Ensure adequate replication (typically minimum n=3) for statistical validity .

    • For membrane proteins like SG1383, controls for proper membrane insertion and orientation are essential.

  • Functional Assay Selection:

    • As UPF0259 family proteins lack well-characterized functions, employ a battery of assays testing various hypotheses:

      • Membrane transport assays (if suspected to be a transporter)

      • Protein-protein interaction assays

      • Enzymatic activity assays

      • Membrane integrity assays

  • Reconstitution Systems:

    • For membrane proteins, consider reconstitution into liposomes or nanodiscs for functional studies in near-native environments.

This systematic approach to experimental design facilitates reliable investigation of SG1383 function while minimizing experimental error and bias.

How can researchers optimize expression and purification of SG1383 for structural studies?

Optimizing the expression and purification of membrane proteins like SG1383 for structural studies presents unique challenges. The following methodological approach is recommended:

  • Expression System Optimization:

    • While E. coli is the standard expression system for SG1383 with N-terminal His tag , consider testing multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3)) specialized for membrane protein expression.

    • Optimize induction conditions (IPTG concentration, temperature, duration) to maximize properly folded protein yield.

    • Consider alternative expression systems (insect cells, yeast) if E. coli yields are insufficient for structural studies.

  • Detergent Screening:

    • Test a panel of detergents for extraction efficiency and protein stability:

      • Mild detergents (DDM, LMNG) for initial extraction

      • Shorter-chain detergents (DM, OG) for crystallization

      • Newer amphipathic agents (SMALPs, amphipols, nanodiscs) for maintaining native-like environment

  • Purification Strategy:

    • Initial purification via His-tag affinity chromatography

    • Secondary purification through size exclusion chromatography to ensure monodispersity

    • Consider ion exchange chromatography as additional purification step if needed

  • Stability Assessment:

    • Thermal stability assays (differential scanning fluorimetry) to identify optimal buffer conditions

    • Limited proteolysis to identify stable domains if full-length protein proves recalcitrant

    • Long-term stability tests at 4°C to determine optimal conditions for structural biology experiments

  • Protein Quality Control:

    • SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) to verify monodispersity and oligomeric state

    • Circular dichroism to verify secondary structure formation

These methodological approaches maximize the likelihood of obtaining properly folded, stable SG1383 suitable for structural studies via X-ray crystallography, cryo-EM, or NMR.

What bioinformatic pipelines are recommended for analyzing SG1383 in the context of Sodalis pseudogenes?

For comprehensive bioinformatic analysis of SG1383 in the context of the pseudogene-rich Sodalis genome, the following analytical pipeline is recommended:

  • Sequence Analysis and Annotation:

    • Combine traditional annotation tools with specialized pseudogene detection algorithms to accurately classify genes and pseudogenes .

    • For SG1383, carefully examine the gene structure for potential inactivating mutations (frameshifts, premature stop codons) that might be overlooked in standard annotation.

  • Transcriptomic Data Analysis:

    • Process stranded RNA-seq data to quantify sense and antisense transcription at the SG1383 locus .

    • Compare expression levels with other functional genes and pseudogenes to place SG1383 in the expression landscape of Sodalis .

    • Analyze nearby transcription start sites and potential operonic structure.

  • Comparative Genomic Analysis:

    • Examine SG1383 across multiple Sodalis isolates to determine its conservation and potential pseudogenization in some lineages .

    • Identify orthologs in related bacteria to infer potential functions based on evolutionary context.

  • Functional Prediction:

    • Apply protein domain prediction, subcellular localization prediction, and structural modeling to generate functional hypotheses.

    • For membrane proteins like SG1383, apply specialized transmembrane topology prediction algorithms to identify potential functional regions.

  • Integration with Proteomic Data:

    • Correlate SG1383 protein abundance data with transcriptomic data to assess post-transcriptional regulation .

    • Analyze potential post-translational modifications that might affect function.

This comprehensive bioinformatic pipeline provides a multi-dimensional perspective on SG1383, facilitating functional hypothesis generation despite the challenges posed by the pseudogene-rich genomic context.

What approaches can be used to investigate the role of SG1383 in host-symbiont interactions?

Investigating the potential role of SG1383 in mediating interactions between Sodalis glossinidius and its tsetse fly host requires a multi-faceted approach:

These methodological approaches provide complementary perspectives on SG1383's potential role in host-symbiont interactions, facilitating understanding of its contribution to the Sodalis-Glossina symbiosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.