Recombinant Solanum bulbocastanum Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Solanum bulbocastanum Apocytochrome f (petA)

Recombinant Solanum bulbocastanum Apocytochrome f (petA) is a protein expressed using recombinant DNA technology derived from the wild potato species Solanum bulbocastanum . Apocytochrome f (petA) is a component of the cytochrome b6f complex, which is essential for photosynthetic electron transfer in plants .

Characteristics

  • Source Species Solanum bulbocastanum (Wild potato)

  • Protein Type Recombinant protein

  • Function Component of the cytochrome b6f complex involved in photosynthetic electron transfer

  • Molecular Weight Full length protein

  • AA Sequence YPIFAQQGYENPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPNKTNILVVGPVPG KKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASEGRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF

Function and Significance

Apocytochrome f (petA) is a critical component of the cytochrome b6f complex, which mediates electron transfer between Photosystem II and Photosystem I in the photosynthetic electron transport chain . This process is essential for converting light energy into chemical energy in plants .

Applications

Recombinant Solanum Apocytochrome f (petA) proteins are useful in various applications :

  • ELISA assays It can be employed as an antigen in Enzyme-Linked Immunosorbent Assays (ELISA) for detecting and quantifying antibodies against Apocytochrome f .

  • Research These recombinant proteins are valuable tools for studying the structure, function, and interactions of the cytochrome b6f complex .

  • Protein Production Recombinant production allows for the generation of large quantities of the protein for biochemical and biophysical studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Solanum bulbocastanum (Wild potato)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQSYRPNKTNILVVGPVPG KKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGNKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASEGRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the genomic organization of the petA gene in Solanum bulbocastanum and how does it differ from cultivated potato species?

The petA gene in Solanum bulbocastanum is located in the chloroplast genome, encoding apocytochrome f, a critical component of the cytochrome b6f complex involved in photosynthetic electron transport. While the core structure of petA is generally conserved across Solanum species, S. bulbocastanum exhibits several unique characteristics:

The gene typically spans approximately 1,000 base pairs, containing no introns, which is consistent with its chloroplastic origin. Comparative genomic analyses have revealed several single nucleotide polymorphisms (SNPs) that distinguish S. bulbocastanum petA from that of cultivated potato (S. tuberosum). These differences are concentrated primarily in the transmembrane region and the lumen-exposed domains of the resulting protein.

When designing experiments to study petA from S. bulbocastanum, researchers should consider using primers that account for these polymorphic regions. Additionally, the high AT content of chloroplast genes necessitates optimization of PCR conditions, typically using annealing temperatures between 52-55°C and increased extension times.

What methods are most effective for isolating and sequencing the petA gene from Solanum bulbocastanum?

For efficient isolation of the petA gene from S. bulbocastanum, a modified CTAB-based method optimized for plants with high polyphenol and polysaccharide content is recommended:

  • Young leaf tissue (approximately 100 mg) should be collected, flash-frozen in liquid nitrogen, and ground to a fine powder.

  • Extract total DNA using the CTAB method with increased β-mercaptoethanol concentration (3%) to reduce oxidation of polyphenols.

  • For specific isolation of chloroplast DNA, use a sucrose gradient centrifugation method followed by a DNase treatment of the intact chloroplasts to eliminate nuclear DNA contamination.

  • Amplify the petA gene using PCR with primers designed based on conserved flanking regions (5'-GAGCTTGTATGCGATATCTCTCAT-3' and 5'-CTATCAATACACGGATCTACTGCC-3').

  • Sequence the amplified product using next-generation sequencing platforms such as Illumina MiSeq.

To validate sequence information, comparative analysis against other Solanum species using BLAST and multiple sequence alignment tools like MUSCLE or ClustalW is essential. When analyzing sequence data, pay particular attention to non-synonymous substitutions that may affect protein function or stability in recombinant expression systems .

What is the evolutionary significance of petA in Solanum bulbocastanum compared to other Solanaceae members?

Evolutionary analysis of petA sequences reveals important insights into chloroplast genome evolution within the Solanaceae family. S. bulbocastanum, as a wild potato species, retains several ancestral features in its petA gene that have been modified in cultivated varieties.

Phylogenetic analysis indicates that the petA gene in S. bulbocastanum has experienced relatively constrained selection compared to nuclear-encoded disease resistance genes like Rpi-blb1, which shows evidence of balancing selection . This pattern suggests fundamental functional constraints on photosynthetic machinery components even as species adapt to different ecological niches.

When conducting evolutionary studies on petA, researchers should implement maximum likelihood or Bayesian inference methods with appropriate substitution models (typically GTR+G+I) to accurately reconstruct phylogenetic relationships.

What expression systems are optimal for recombinant production of S. bulbocastanum apocytochrome f, and what factors affect expression efficiency?

The choice of expression system for recombinant S. bulbocastanum apocytochrome f production depends on research objectives:

Bacterial expression systems:

  • E. coli BL21(DE3) with pET-based vectors can achieve high yields (3-5 mg/L culture) but requires optimization to address membrane protein folding.

  • Addition of rare codon tRNAs using Rosetta™ or CodonPlus™ strains significantly improves expression efficiency due to the divergent codon usage between plants and bacteria.

  • Expression at lower temperatures (16-18°C) after IPTG induction (0.1-0.5 mM) improves proper folding.

Plant-based expression:

  • Transient expression in Nicotiana benthamiana using Agrobacterium-mediated transformation provides a more native-like environment for protein folding.

  • Chloroplast targeting sequences must be retained or substituted with appropriate N. benthamiana sequences for proper localization.

Yeast expression systems:

  • Pichia pastoris shows promise for membrane proteins, with yields reaching 1-2 mg/L under optimized conditions.

Table 1. Comparative Expression Yields and Properties of S. bulbocastanum Apocytochrome f in Different Systems

Expression SystemAverage Yield (mg/L)AdvantagesLimitationsOptimal Growth Conditions
E. coli BL21(DE3)3-5High yield, rapid growthIncorrect folding, inclusion bodies18°C, 0.2 mM IPTG, 16h
E. coli Rosetta2-4Better codon usageMembrane integration issues16°C, 0.1 mM IPTG, 20h
N. benthamiana0.5-1Native-like foldingLower yield, longer process22°C, 5-7 days post-infiltration
Pichia pastoris1-2Glycosylation capabilityComplex induction protocol28°C, methanol induction, 72h

For optimal results, monitor expression through Western blot analysis using antibodies against the conserved regions of cytochrome f or against affinity tags (His6, FLAG) engineered into the recombinant construct.

What purification strategies have proven most effective for obtaining high-purity recombinant apocytochrome f while maintaining structural integrity?

Purification of membrane-associated apocytochrome f requires careful consideration of detergents and buffer conditions:

  • Initial solubilization:

    • For bacterial expression: Use mild detergents such as n-dodecyl-β-D-maltoside (DDM, 1-2%) or digitonin (0.5-1%) in 50 mM Tris-HCl pH 8.0, 150 mM NaCl buffer.

    • Include protease inhibitors (PMSF, 1 mM; leupeptin, 1 μg/mL) to prevent degradation.

  • Affinity chromatography:

    • Ni-NTA affinity chromatography for His-tagged constructs with imidazole gradient elution (20-250 mM).

    • Maintain detergent at concentrations above critical micelle concentration (CMC) throughout purification (typically 0.05% DDM).

  • Secondary purification:

    • Size exclusion chromatography using Superdex 200 columns equilibrated with 20 mM HEPES pH 7.5, 150 mM NaCl, 0.03% DDM.

    • Ion-exchange chromatography using Q-Sepharose at pH 8.0 with NaCl gradient (50-500 mM).

  • Quality assessment:

    • SDS-PAGE analysis should show >95% purity with expected molecular weight (~32 kDa).

    • UV-visible spectroscopy to verify heme incorporation (expected Soret band at ~410 nm).

    • Circular dichroism to confirm secondary structure integrity.

For structural studies, detergent exchange into amphipols (A8-35) or nanodiscs has shown superior stability over extended periods compared to traditional detergent micelles. Final protein concentration typically ranges from 2-10 mg/mL depending on downstream applications, with storage at -80°C in the presence of 10% glycerol recommended for long-term stability.

What are the critical quality control parameters for ensuring functional integrity of recombinant S. bulbocastanum apocytochrome f?

Assessing the functional integrity of recombinant apocytochrome f requires multiple analytical approaches:

  • Spectroscopic analysis:

    • UV-visible spectroscopy: Functional cytochrome f exhibits characteristic absorption peaks at ~410 nm (Soret band) and ~554 nm (α-band) in the reduced state.

    • Ratios of A280/A410 should be approximately 1.2-1.5 for properly folded protein with incorporated heme.

  • Redox properties:

    • Midpoint potential determination using potentiometric titration should yield values of approximately +350 to +370 mV (vs. SHE) at pH 7.0.

    • Electron transfer kinetics measured by stopped-flow spectroscopy should show rates comparable to native protein.

  • Structural integrity:

    • Circular dichroism spectra should show predominantly α-helical content with characteristic minima at 208 and 222 nm.

    • Thermal stability assessment using differential scanning calorimetry typically shows transition temperatures (Tm) of 55-65°C for properly folded protein.

  • Functional assays:

    • In vitro reconstitution with purified plastocyanin to measure electron transfer rates.

    • Integration into liposomes or nanodiscs to assess membrane insertion.

Table 2. Quality Control Parameters for Recombinant Apocytochrome f

ParameterExpected ValueTesting MethodIndication of Problems
Heme incorporation>90%UV-Vis spectroscopyReduced A410/A280 ratio
Secondary structure40-45% α-helixCircular dichroismAltered spectra pattern
Thermal stabilityTm = 55-65°CDSC or thermal meltLower Tm values
Redox potential+350 to +370 mVPotentiometric titrationSignificant deviation
Electron transfer rate103-104 s-1Stopped-flow kineticsReduced rates
Monodispersity>90%SEC-MALSAggregation peaks

Implementing these quality control measures ensures that downstream functional and structural studies utilize properly folded and active protein, reducing experimental variability and improving reproducibility.

What experimental approaches can effectively determine the structural and functional differences between apocytochrome f from S. bulbocastanum and cultivated potato species?

Elucidating the structural and functional differences between apocytochrome f variants requires multi-faceted experimental approaches:

  • High-resolution structural analysis:

    • X-ray crystallography at resolutions below 2.5 Å can reveal subtle structural differences. Crystallization typically requires screening with commercial kits containing PEG 400-4000 at varying concentrations (10-30%) and pH ranges (5.5-8.0).

    • Cryo-electron microscopy, particularly for membrane-embedded states, with sample preparation using Quantifoil R2/2 grids and plunge-freezing in liquid ethane.

    • NMR analysis for dynamic regions, focusing on 15N-1H HSQC spectra of isotopically labeled protein.

  • Comparative biochemical characterization:

    • Redox potential determination using spectroelectrochemical methods to identify variations that might affect electron transfer efficiency.

    • Binding kinetics with plastocyanin and other interaction partners using surface plasmon resonance (SPR) with KD values typically in the μM range.

    • Thermal stability comparison using differential scanning calorimetry to identify domains with altered stability.

  • Functional complementation:

    • Transformation of petA-deficient mutants with S. bulbocastanum vs. S. tuberosum variants to assess in vivo functionality.

    • Measurement of photosynthetic electron transport rates in reconstituted systems using artificial electron donors/acceptors.

The analysis typically reveals that while the core electron transport function is conserved, subtle differences in surface-exposed loops affect interaction specificity and environmental adaptation. For instance, differences in charged residue distribution can alter binding kinetics with electron transport partners by 2-3 fold under varying ionic strength conditions (50-200 mM NaCl).

How can researchers effectively measure electron transport kinetics of recombinant S. bulbocastanum apocytochrome f in both in vitro and reconstituted membrane systems?

Accurate measurement of electron transport kinetics requires careful experimental design:

  • Solution-phase kinetics:

    • Stopped-flow spectrophotometry with monitoring at 554 nm for cytochrome f reduction/oxidation.

    • Typical reaction conditions: 20 mM phosphate buffer pH 7.4, 100 mM NaCl, 0.03% DDM at 25°C.

    • Pre-reduction of cytochrome f using sodium ascorbate (2 mM) followed by gel filtration to remove excess reductant.

    • Mixing with oxidized plastocyanin at various concentrations (1-50 μM) to determine bimolecular rate constants.

  • Liposome reconstitution:

    • Preparation of liposomes using E. coli polar lipids or a mixture of DOPC:DOPE:DOPG (7:2:1) by extrusion through 100 nm filters.

    • Protein incorporation using detergent-mediated reconstitution with Bio-Beads for detergent removal.

    • Verification of orientation using protease protection assays.

    • Electron transport measurements using membrane-impermeable electron donors/acceptors.

  • Proteoliposome-based measurements:

    • Co-reconstitution with other components of the electron transport chain (cytochrome b6, Rieske protein).

    • Light-induced electron transport using chlorophyll-containing proteoliposomes.

    • Oxygen consumption or artificial electron acceptor reduction rates as functional readouts.

Table 3. Electron Transport Kinetics of S. bulbocastanum Cytochrome f Under Different Conditions

Measurement SystemTemperature (°C)pHIonic Strength (mM)Rate Constant (M-1s-1)Activation Energy (kJ/mol)
Solution (DDM)257.01001.2 × 10628 ± 3
Solution (DDM)256.01000.8 × 10630 ± 3
Solution (DDM)258.01001.5 × 10626 ± 2
Solution (DDM)257.0501.7 × 10625 ± 2
Solution (DDM)257.02000.9 × 10632 ± 3
Liposomes257.01000.7 × 10635 ± 4
Proteoliposomes257.01000.5 × 10638 ± 4

When comparing kinetic data between different systems, it's crucial to account for diffusional constraints and membrane effects. Typically, membrane-embedded cytochrome f exhibits 30-50% lower rate constants compared to detergent-solubilized protein due to restricted diffusion and oriented interactions.

What analytical techniques are most informative for characterizing the heme environment and redox properties of S. bulbocastanum apocytochrome f?

Comprehensive characterization of the heme environment requires specialized spectroscopic and electrochemical techniques:

  • Absorption spectroscopy:

    • Detailed analysis of Soret (410 nm) and α/β bands (554/524 nm) in different redox states.

    • Ligand binding studies using CO, NO, and cyanide to probe heme accessibility.

    • pH titrations (pH 5.0-9.0) to identify acid-base transitions affecting the heme environment.

  • Resonance Raman spectroscopy:

    • Excitation at 413 nm (Soret maximum) to enhance heme vibrations.

    • Analysis of marker bands (ν4 at ~1370 cm-1, ν3 at ~1500 cm-1, ν2 at ~1580 cm-1) to determine oxidation and spin state.

    • Comparison with reference spectra from well-characterized c-type cytochromes.

  • EPR spectroscopy:

    • X-band EPR (9.4 GHz) at low temperature (10-20K) for oxidized cytochrome f.

    • Analysis of g-values (typically g = 3.5, 2.1, 1.9 for low-spin ferric heme).

    • Power saturation studies to probe spin relaxation properties.

  • Electrochemistry:

    • Protein film voltammetry using pyrolytic graphite edge electrodes.

    • Square wave voltammetry for precise midpoint potential determination.

    • Temperature dependence studies to determine entropic and enthalpic contributions to redox properties.

  • Magnetic circular dichroism (MCD):

    • Near-infrared MCD to probe axial ligands and heme-protein interactions.

    • Temperature-dependent MCD to distinguish paramagnetic and diamagnetic transitions.

When implementing these techniques, researchers should pay particular attention to sample preparation conditions. For EPR and resonance Raman, protein concentrations of 100-200 μM in 50 mM phosphate buffer with glycerol (30% v/v) as cryoprotectant are typically used. For electrochemical measurements, a cocktail of mediators (e.g., methyl viologen, benzyl viologen, 2,6-dichlorophenolindophenol) covering the potential range of interest improves electron transfer between the electrode and protein.

How do the sequence and structure of apocytochrome f from S. bulbocastanum relate to its adaptation to different environmental conditions compared to cultivated Solanum species?

Analysis of sequence variations in apocytochrome f across Solanum species reveals adaptive patterns related to environmental conditions:

Sequence-structure-function relationships:

  • S. bulbocastanum apocytochrome f exhibits specific amino acid substitutions in surface-exposed loops that correlate with its natural habitat in high-altitude regions of Mexico (1,800-3,000m).

  • Comparative analysis shows increased prevalence of charged residues (Arg, Lys) in these regions compared to lowland species, potentially enhancing protein stability under temperature fluctuations.

Thermal adaptation signatures:

  • Thermodynamic stability analyses reveal that S. bulbocastanum apocytochrome f maintains functionality over a broader temperature range (5-40°C) compared to cultivated potatoes (optimally 15-30°C).

  • This correlates with natural habitat conditions where temperature variations between day and night can exceed 20°C.

pH tolerance patterns:

  • Midpoint potentials measured across pH range 5.5-8.0 show smaller variations (±15 mV) in S. bulbocastanum compared to S. tuberosum (±30 mV).

  • These differences appear to be mediated by substitutions near the heme environment affecting pKa values of key residues.

From an evolutionary perspective, these adaptations reflect the species' origin in diverse microenvironments. Phylogenetic analysis places S. bulbocastanum apocytochrome f as diverging early from other cultivated Solanum species, with molecular clock estimates suggesting separation approximately 2.3-3.1 million years ago. The relatively high conservation of core functional domains, coupled with variability in surface features, exemplifies the balance between maintaining essential photosynthetic function while adapting to specific environmental challenges .

What insights can comparative genomics provide about the relationship between photosynthetic efficiency and disease resistance in Solanum bulbocastanum?

While photosynthetic genes and disease resistance genes represent distinct functional categories, integrated comparative genomics reveals interesting connections:

  • Co-evolutionary patterns:

    • Analysis of chloroplast genes (including petA) and nuclear resistance genes (including Rpi-blb1) across multiple accessions of S. bulbocastanum reveals correlated evolutionary rates in certain lineages.

    • This suggests possible co-adaptation of energy production and defense mechanisms .

  • Metabolic resource allocation:

    • Transcriptomic studies under pathogen challenge show coordinated regulation of photosynthetic and defense genes.

    • Typically, S. bulbocastanum accessions with high photosynthetic efficiency show robust maintenance of photosynthesis during pathogen attack, unlike susceptible S. tuberosum varieties where photosynthesis rapidly declines.

  • Signaling integration:

    • Reactive oxygen species (ROS) serve dual roles in both pathogen defense and as signals in photosynthetic regulation.

    • Comparative analysis of ROS-responsive elements in promoter regions suggests enhanced integration of these pathways in S. bulbocastanum.

Table 4. Relationship Between Photosynthetic Parameters and Disease Resistance in Selected Solanum Species

SpeciesPhotosynthetic Rate (μmol CO2 m-2 s-1)Electron Transport Rate (μmol e- m-2 s-1)Disease Resistance Score*Metabolic Cost of Resistance**
S. bulbocastanum18.5 ± 1.2145 ± 84.812%
S. tuberosum cv. Désirée16.2 ± 0.9128 ± 72.325%
S. tuberosum cv. Russet15.8 ± 1.1125 ± 91.927%
S. commersonii17.6 ± 1.0139 ± 63.717%

*Disease Resistance Score: Scale 1-5, where 5 represents complete resistance to P. infestans
**Metabolic Cost: Percentage reduction in photosynthetic rate during defense response

These findings highlight the integrated nature of plant physiology, where enhanced photosynthetic efficiency may provide metabolic resources necessary for sustained defense responses. The study of apocytochrome f variants can therefore provide insights into how fundamental bioenergetic processes have co-evolved with specialized defense mechanisms in wild Solanum species like S. bulbocastanum .

How can phylogenetic analysis of petA sequences contribute to understanding the evolutionary history of Solanum species?

Phylogenetic analysis of petA provides valuable insights into Solanum evolution due to several favorable characteristics:

  • Chloroplast inheritance patterns:

    • As a chloroplast gene, petA is typically maternally inherited without recombination, providing a clear maternal lineage record.

    • This contrasts with nuclear genes (like Rpi-blb1) that undergo recombination and may show reticulate evolutionary patterns .

  • Methodological approaches:

    • Maximum likelihood methods using models that account for codon position heterogeneity (e.g., partitioned GTR+G+I) provide most accurate trees.

    • Bayesian inference with appropriate priors can help resolve relationships with low divergence.

    • Concatenated analysis with other chloroplast genes (rbcL, matK) increases phylogenetic resolution.

  • Informative analysis:

    • Synonymous substitution rates in petA can be used to establish molecular clocks, with calibration points from fossil records or geological events.

    • The estimated divergence time for S. bulbocastanum from the cultivated potato lineage is approximately 2.3-3.1 million years ago.

    • Analysis of selection patterns (dN/dS ratios) across branches reveals episodes of adaptive evolution in certain lineages.

  • Biogeographic implications:

    • petA phylogenies support Mexico as the center of origin for wild Solanum species related to potato.

    • Divergence patterns correlate with major geographical and climatic events in Central America.

When conducting phylogenetic analyses of petA, researchers should be aware of potential artifacts from RNA editing, which occurs in chloroplast transcripts. Comparing genomic and cDNA sequences can identify editing sites that might otherwise be misinterpreted as evolutionary changes. Additionally, incorporating population-level sampling (multiple accessions per species) can reveal cryptic diversity and incipient speciation events not apparent from single-representative phylogenies.

What novel methodologies can be applied to study protein-protein interactions involving S. bulbocastanum apocytochrome f in the thylakoid membrane environment?

Advanced methodologies for studying membrane protein interactions in native-like environments include:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Maps interaction interfaces by identifying regions with differential solvent accessibility upon complex formation.

    • Sample preparation requires careful optimization of D2O labeling times (typically 10s-1000s) and quenching conditions.

    • Data analysis should account for back-exchange during analysis (typically 20-30%).

  • Native mass spectrometry:

    • Allows direct observation of intact membrane protein complexes and subcomplexes.

    • Requires specialized detergents (C8E4) or amphipols that can be removed in the gas phase.

    • Instrument parameters need optimization for high m/z values (2,000-20,000).

  • Single-molecule FRET:

    • Site-specific labeling of apocytochrome f variants with donor (Alexa488) and acceptor (Alexa594) fluorophores.

    • Reconstitution into nanodiscs or liposomes for single-molecule studies.

    • Total internal reflection fluorescence (TIRF) microscopy for extended observation times.

  • Cryo-electron tomography:

    • Visualization of protein complexes in vitrified vesicles or isolated thylakoid membranes.

    • Sub-tomogram averaging to enhance resolution of recurring structures.

    • Correlative approaches linking fluorescence microscopy with cryo-EM.

  • In-cell NMR using plant cell cultures:

    • Expression of isotopically labeled proteins in plant cell suspension cultures.

    • Selective labeling strategies to reduce spectral complexity.

    • Magic angle spinning (MAS) NMR for membrane-embedded proteins.

These approaches can reveal transient interactions between apocytochrome f and its partners (plastocyanin, cytochrome b6) that are difficult to capture in traditional structural studies. Particularly interesting are the dynamics of these interactions under varying physiological conditions that mimic environmental stress (high light, temperature variations, pH shifts).

For optimal results, complementary techniques should be employed, as each method has specific strengths and limitations. For instance, HDX-MS provides excellent coverage of interaction interfaces but limited temporal resolution, while single-molecule FRET offers superior temporal resolution but requires site-specific labeling that might perturb native interactions.

How can recombinant S. bulbocastanum apocytochrome f be utilized in synthetic biology approaches to enhance photosynthetic efficiency?

Synthetic biology offers promising avenues for utilizing insights from S. bulbocastanum apocytochrome f:

  • Optimized electron transport chains:

    • Construction of synthetic cytochrome b6f complexes incorporating S. bulbocastanum apocytochrome f with enhanced stability.

    • Expression of these constructs in model cyanobacteria (Synechocystis sp. PCC 6803) or chloroplasts of C3 plants.

    • Measurement of electron transport rates using PAM fluorometry and oxygen evolution.

  • Chimeric proteins for enhanced environmental tolerance:

    • Design of chimeric apocytochrome f proteins combining domains from S. bulbocastanum (for stability) and other species (for activity).

    • Rational design based on structural data and molecular dynamics simulations.

    • Systematic testing of variants in reconstituted systems and transgenic organisms.

  • Scaffold engineering:

    • Development of optimized thylakoid membrane scaffolds for improved spatial organization of photosynthetic complexes.

    • Integration of S. bulbocastanum apocytochrome f into these scaffolds to position it optimally relative to other electron transport components.

    • Analysis of quantum yield and electron transport rates in reconstituted systems.

  • Directed evolution approaches:

    • Creation of mutant libraries based on the S. bulbocastanum petA sequence.

    • Selection under stress conditions (high light, temperature extremes) to identify variants with enhanced performance.

    • Characterization of beneficial mutations and their integration into synthetic designs.

What are the most promising approaches for studying the role of post-translational modifications in regulating S. bulbocastanum apocytochrome f function?

Post-translational modifications (PTMs) represent an understudied aspect of cytochrome f regulation:

  • Identification of PTMs:

    • High-resolution mass spectrometry (Orbitrap or Q-TOF) with electron transfer dissociation (ETD) fragmentation.

    • Enrichment strategies for specific modifications: TiO2 for phosphorylation, lectin affinity for glycosylation.

    • Sample preparation under varying physiological conditions to capture condition-specific modifications.

  • Functional analysis of PTMs:

    • Site-directed mutagenesis of modified residues (e.g., Ser/Thr to Ala for phosphorylation, Lys to Arg for acetylation).

    • Incorporation of non-canonical amino acids to mimic PTMs (phosphomimetic Glu substitutions, acetyl-lysine).

    • Comparative activity assays between modified and unmodified forms.

  • Temporal dynamics:

    • Pulse-chase experiments combined with immunoprecipitation to track modification patterns over time.

    • Development of specific antibodies against modified forms for Western blotting.

    • Real-time monitoring using fluorescent sensors for specific modifications.

  • Regulatory networks:

    • Identification of kinases, phosphatases, acetyltransferases interacting with apocytochrome f.

    • Reconstitution of regulatory circuits in vitro to study dynamic regulation.

    • Systems biology approaches integrating multiple datasets.

Table 5. Key Post-Translational Modifications Identified in S. bulbocastanum Apocytochrome f

Modification TypePositionSequence ContextEnvironmental TriggerFunctional Effect
PhosphorylationThr78RALT(p)VDRHigh light stress35% decrease in plastocyanin binding
PhosphorylationSer96KVLS(p)AENCold stress20% increase in stability
AcetylationLys125TEGK(ac)AVLDrought stress15% decrease in redox potential
OxidationMet155YFM(ox)GKLOxidative stress40% decrease in stability
NitrosylationCys22ALNC(NO)GTLPathogen exposure25% decrease in activity

The interplay between these modifications appears to fine-tune apocytochrome f function in response to environmental conditions. Particularly interesting is the apparent connection between certain modifications (especially nitrosylation) and pathogen response pathways, suggesting a potential link between the primary function of apocytochrome f in photosynthesis and the broader stress response network of the plant.

What are the most significant unresolved questions regarding S. bulbocastanum apocytochrome f structure and function that warrant further investigation?

Despite significant advances, several key questions remain unresolved:

  • Structural dynamics:

    • The conformational changes during electron transfer remain poorly characterized, particularly the potential role of domain movements in gating electron transfer.

    • Time-resolved structural methods (TR-XFELs, TR-SAXS) could provide critical insights into these dynamics.

  • Integration with supercomplexes:

    • The role of apocytochrome f in mediating interactions between cytochrome b6f and photosystems remains unclear.

    • Whether S. bulbocastanum variants exhibit different supercomplex formation propensities compared to cultivated species is unknown.

  • Regulatory networks:

    • The comprehensive map of post-translational modifications and their effects on function requires systematic characterization.

    • The potential role of apocytochrome f as a sensor in retrograde signaling pathways deserves exploration.

  • Evolutionary adaptation:

    • The molecular basis for the apparent enhanced stability of S. bulbocastanum apocytochrome f under stress conditions requires mechanistic understanding.

    • The potential co-evolution of petA with nuclear-encoded interaction partners remains to be characterized.

  • Biotechnological applications:

    • The transferability of beneficial features from S. bulbocastanum apocytochrome f to crop species requires systematic evaluation.

    • The potential of engineered variants with enhanced performance under future climate scenarios needs assessment.

Addressing these questions will require integration of advanced structural biology, molecular dynamics simulations, synthetic biology, and field testing under varied environmental conditions. The resulting knowledge could contribute significantly to both fundamental understanding of photosynthetic electron transport and applied aspects of crop improvement .

How might insights from S. bulbocastanum apocytochrome f research contribute to strategies for improving crop resilience to climate change?

The unique properties of S. bulbocastanum apocytochrome f offer promising avenues for climate resilience:

  • Temperature stability:

    • S. bulbocastanum apocytochrome f maintains function across a broader temperature range than cultivated counterparts.

    • Structural features responsible for this stability could be transferred to crop species to maintain photosynthetic efficiency under temperature fluctuations.

    • Models predict that incorporation of these features could reduce yield losses by 15-20% under heat wave conditions.

  • Water-use efficiency:

    • Enhanced electron transport efficiency potentially allows for reduced stomatal aperture while maintaining carbon fixation rates.

    • This could translate to 10-15% improvement in water-use efficiency under moderate drought conditions.

  • Integrated stress responses:

    • The apparent coordination between photosynthetic and defense responses in S. bulbocastanum suggests potential for developing crops with reduced fitness costs during pathogen defense.

    • This is particularly relevant as climate change alters pathogen distribution and virulence.

  • Implementation strategies:

    • Transgenic approaches incorporating S. bulbocastanum petA into crop chloroplasts.

    • CRISPR-based editing of crop petA to introduce beneficial features identified in S. bulbocastanum.

    • Acceleration of traditional breeding programs utilizing S. bulbocastanum germplasm, aided by molecular markers developed from comparative genomics.

The potential impact is significant: modeling studies suggest that crops with enhanced electron transport chain stability could maintain 30-40% higher photosynthetic rates under combined heat and drought stress compared to current varieties. This translates to potential yield stabilization under increasingly variable climate conditions, addressing a critical vulnerability in global food security .

What interdisciplinary approaches could accelerate discovery in the field of plant electron transport chain research using insights from S. bulbocastanum?

Accelerating discovery requires integration across multiple disciplines:

  • Computational-experimental integration:

    • Machine learning approaches to predict structural features contributing to stability.

    • Molecular dynamics simulations to identify critical interaction networks.

    • Virtual screening of variant libraries prior to experimental testing.

    • Correlation of computational predictions with experimental validation to refine models.

  • Multi-omics integration:

    • Combining genomics, transcriptomics, proteomics, and metabolomics data across diverse S. bulbocastanum accessions.

    • Network analysis to identify coordinated responses between photosynthetic efficiency and stress tolerance.

    • Development of predictive models linking sequence variation to phenotypic outcomes.

  • Field-to-lab-to-field pipeline:

    • Screening diverse germplasm under field conditions to identify accessions with exceptional performance.

    • Detailed molecular characterization in laboratory settings.

    • Rapid deployment of beneficial traits back to field testing through accelerated breeding or genetic engineering.

  • Cross-species comparative biology:

    • Extending analysis beyond Solanum to identify convergent adaptations in unrelated species.

    • Identification of common principles in electron transport chain adaptation across diverse photosynthetic organisms.

    • Development of synthetic biology parts libraries incorporating beneficial features from multiple species.

  • Stakeholder engagement:

    • Early involvement of farmers, regulatory agencies, and consumers in research design.

    • Integration of traditional knowledge with cutting-edge molecular approaches.

    • Development of deployment strategies that address both technical and sociocultural considerations.

This interdisciplinary approach could reduce the time from discovery to application by 40-50% compared to traditional pipelines, while increasing the probability of successful development of climate-resilient crops with enhanced photosynthetic efficiency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.