Recombinant Solanum bulbocastanum ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Solanum bulbocastanum (Wild potato)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across the membrane.

Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (atpI) in chloroplasts?

ATP synthase subunit a (atpI) is a membrane-embedded component of the CF0 subcomplex of the chloroplast ATP synthase. This subunit is critical for proton translocation across the thylakoid membrane, converting energy from proton flux into rotational motion that drives ATP synthesis. The protein contains multiple transmembrane domains and forms part of the proton channel through which protons flow down their electrochemical gradient .

The ATP synthase complex in chloroplasts consists of two main subcomplexes: the membrane-embedded CF0 (containing subunit a) and the water-soluble CF1. Together, they couple the energy from the light-driven proton gradient to ATP synthesis in a process fundamental to photosynthesis .

How is the atpI gene organized in the Solanum bulbocastanum chloroplast genome?

The atpI gene in S. bulbocastanum is encoded by the chloroplast genome, which typically ranges from 115-165 kb in size. Like other chloroplast genomes, S. bulbocastanum contains a large single copy (LSC) region, a small single copy (SSC) region, and two inverted repeat regions (IRA and IRB) .

The atpI gene is typically located in the LSC region of the chloroplast genome. Based on comparative analyses with related Solanaceae species, the gene organization surrounding atpI is likely conserved, with specific intergenic spacer regions that could be utilized for homologous recombination in chloroplast transformation experiments .

What expression systems are recommended for producing recombinant chloroplastic atpI?

For heterologous expression of chloroplast membrane proteins like atpI, several expression systems can be considered:

For optimal expression, incorporating the native regulatory elements (promoters, 5'-UTRs, and 3'-UTRs) from S. bulbocastanum is recommended, as these elements significantly impact transgene expression levels in chloroplast transformation experiments .

How can I design efficient primers for amplifying the atpI gene from Solanum bulbocastanum?

Designing effective primers for S. bulbocastanum atpI amplification requires careful consideration of several factors:

  • Sequence conservation analysis: Align atpI sequences from related Solanaceae species to identify conserved regions suitable for primer design. Focus on regions with high sequence identity, particularly at the 3' ends of primers.

  • Primer parameters:

    • Optimal primer length: 18-25 nucleotides

    • GC content: 40-60%

    • Melting temperature (Tm): 55-65°C, with both primers having similar Tm

    • Avoid secondary structures or primer-dimer formation

  • Amplification strategy: Include appropriate restriction sites at the 5' ends of primers (with 3-4 additional nucleotides as overhangs) to facilitate directional cloning into expression vectors.

  • Verification approach: Design primers to amplify not only the coding sequence but also include flanking regions to verify that the product originates from the chloroplast genome rather than potential nuclear pseudogenes .

Touchdown PCR protocols often provide better specificity when working with plant templates like S. bulbocastanum that may contain complex polysaccharides and secondary metabolites.

What purification methods are most effective for isolating recombinant atpI protein?

Purifying membrane proteins like atpI presents unique challenges that require specialized approaches:

  • Solubilization optimization: Test multiple detergents (DDM, LMNG, digitonin) at various concentrations to identify optimal solubilization conditions that maintain protein structure and function. A detergent screen is recommended before large-scale purification.

  • Affinity chromatography: For recombinant atpI, incorporating an affinity tag (His6, Strep-tag II, or FLAG) allows for initial capture using affinity resins. The peripheral location of the N-terminus makes it a preferred site for tag placement.

  • Size exclusion chromatography: This serves as a crucial polishing step to separate properly folded protein from aggregates and to verify the oligomeric state of the protein.

  • Assessment of purity and integrity: Use SDS-PAGE analysis followed by western blotting with antibodies specific to atpI or the affinity tag to confirm identity. Mass spectrometry analysis can further verify protein integrity and post-translational modifications .

Maintaining the cold chain (4°C) throughout the purification process and including protease inhibitors in all buffers is essential for preserving protein integrity.

How can I assess the proper folding and functionality of recombinant atpI?

Multiple complementary approaches should be employed to verify the structural integrity and functionality of recombinant atpI:

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure content (α-helices, β-sheets) to evaluate proper folding.

  • Reconstitution assays: Incorporate purified atpI into liposomes and measure proton translocation using pH-sensitive fluorescent dyes (ACMA, pyranine).

  • Complex assembly assessment: Co-expression with other ATP synthase subunits followed by blue native PAGE analysis can demonstrate the ability of recombinant atpI to assemble into higher-order complexes.

  • Complementation studies: Transform atpI-deficient mutants with the recombinant gene and assess restoration of phenotype, particularly photosynthetic efficiency under varying light conditions .

  • Thermal stability assays: Using fluorescent probes (CPM, SYPRO Orange) to monitor protein unfolding can provide insights into protein stability and the effects of different buffer conditions.

These methods collectively provide a comprehensive assessment of whether the recombinant atpI retains its native structure and functional properties.

How can site-directed mutagenesis of conserved residues in atpI inform its role in proton translocation?

Site-directed mutagenesis of atpI can provide valuable insights into structure-function relationships:

  • Target selection strategy:

    • Conserved acidic residues (Asp, Glu) in transmembrane domains are prime candidates as they often participate directly in proton translocation

    • Residues at the interface with other subunits to understand subunit interactions

    • Amino acids unique to S. bulbocastanum compared to model organisms

  • Experimental approach:

    • Generate a panel of point mutations (conservative and non-conservative substitutions)

    • Express mutants in an appropriate system (bacterial or chloroplast transformation)

    • Assess the impact on ATP synthase assembly, proton conductance, and ATP synthesis rates

  • Functional analysis:

    • Measure pmf (proton motive force) thresholds required for ATP synthesis activation

    • Quantify proton leakage rates through the complex

    • Determine effects on redox regulation of the complex

Similar approaches have successfully identified critical residues in the γ subunit that specifically affect light regulation but not metabolism-induced regulation of ATP synthase activity . A systematic mutation analysis of conserved acidic residues in atpI would likely reveal residues specifically involved in proton channeling versus structural stability.

What are the approaches for studying the interaction between atpI and other ATP synthase subunits?

Understanding subunit interactions is crucial for elucidating ATP synthase assembly and function:

  • Crosslinking coupled with mass spectrometry (XL-MS):

    • Use bifunctional crosslinkers with different spacer lengths

    • Digest crosslinked complexes and analyze by LC-MS/MS

    • Identify crosslinked peptides to map interaction interfaces

  • Coevolution analysis:

    • Compare sequences across diverse plant species to identify coevolving residue pairs

    • Such pairs often indicate physical contacts between subunits

    • Validate predicted interactions through targeted mutagenesis

  • Yeast two-hybrid and split-GFP approaches:

    • Modified for membrane proteins using specialized vectors

    • Map specific domains involved in interactions

    • Quantify interaction strengths under different conditions

  • Cryo-electron microscopy:

    • Provides structural insights at near-atomic resolution

    • Can reveal conformational changes during the catalytic cycle

    • Allows visualization of how mutations affect complex architecture

Peripheral stalk subunits (like b and b') have been shown to be essential for ATP synthase biogenesis and stability . Similar approaches could identify specific interactions between atpI and these structural components.

How does the redox environment affect atpI function and ATP synthase assembly?

The redox regulation of chloroplast ATP synthase is a complex process that may involve multiple subunits:

  • Redox-sensitive residue identification:

    • Examine atpI sequence for conserved cysteine residues

    • Perform differential alkylation experiments under oxidizing vs. reducing conditions

    • Use mass spectrometry to identify modified residues

  • Thiol-disulfide exchange studies:

    • Monitor the redox state using AMS (4-acetamido-4'-maleimidylstilbene-2,2'-disulfonate) labeling followed by non-reducing SDS-PAGE

    • Test the effects of different thioredoxins on the redox state of atpI

    • Quantify the redox midpoint potential using titration with oxidized/reduced DTT

  • Functional impact assessment:

    • Compare ATP synthase activity under varying redox conditions

    • Monitor complex assembly in different redox environments

    • Assess whether atpI contributes to the thioredoxin-mediated regulation

While the γ subunit contains a regulatory disulfide bridge that modulates ATP synthase activity in response to light conditions , the potential role of atpI in redox regulation represents an unexplored area that could reveal additional regulatory mechanisms.

How can CRISPR-Cas9 technology be applied to study atpI function in planta?

CRISPR-Cas9 offers powerful approaches for studying chloroplast genes:

  • Chloroplast genome editing strategies:

    • Design sgRNAs targeting specific regions of atpI

    • Optimize chloroplast-targeted Cas9 expression

    • Use homology-directed repair templates to introduce precise mutations

  • Experimental design considerations:

    • Target conserved functional domains versus variable regions

    • Create an allelic series with varying functional impacts

    • Include appropriate selection markers and screening strategies

  • Phenotypic analysis framework:

    • Assess photosynthetic parameters (Fv/Fm, ETR, NPQ)

    • Measure ATP synthesis rates under different light intensities

    • Evaluate plant growth and development under various conditions

  • Complementation strategies:

    • Rescue mutations with wild-type or modified atpI variants

    • Use inducible expression systems to control timing

    • Incorporate tissue-specific promoters to study spatial requirements

Recent work has successfully used CRISPR-Cas9 to generate knock-out mutations in chloroplast ATP synthase subunits, demonstrating that some subunits are essential for complex accumulation and function while others allow small amounts of functional complex to be assembled .

What approaches can be used to study the role of atpI in coordinating nuclear-chloroplast communication?

The biogenesis of chloroplast ATP synthase requires coordinated expression of nuclear and chloroplast-encoded subunits:

  • Transcriptome synchronization analysis:

    • Compare expression patterns of nuclear-encoded ATP synthase subunits with atpI under various conditions

    • Identify transcription factors that might coordinate expression

    • Use reporter gene constructs to monitor expression dynamics in real-time

  • Protein import and assembly studies:

    • Track the import of nuclear-encoded subunits into chloroplasts

    • Monitor assembly intermediates during complex formation

    • Identify assembly factors that specifically interact with atpI

  • Signaling cascade investigation:

    • Analyze retrograde signaling pathways activated by atpI dysfunction

    • Characterize changes in nuclear gene expression following atpI mutation

    • Identify protein partners that might function in signaling

This research direction builds on findings that nuclear-encoded factors like OPR proteins are required for stabilization of chloroplast mRNAs encoding ATP synthase subunits . Similar factors may exist for atpI mRNA processing and could represent crucial components of nuclear-chloroplast communication.

How does atpI contribute to environmental stress adaptation in Solanum bulbocastanum?

Wild potato species like S. bulbocastanum have evolved stress resistance mechanisms that may involve ATP synthase regulation:

  • Comparative stress response analysis:

    • Expose plants to diverse stresses (drought, salt, temperature extremes)

    • Monitor atpI expression, protein accumulation, and post-translational modifications

    • Compare responses between S. bulbocastanum and cultivated potato species

  • ATP synthase activity regulation:

    • Measure ATP synthase activity under stress conditions

    • Assess proton gradient modulation as a response mechanism

    • Quantify changes in thylakoid membrane organization

  • Stress-responsive elements identification:

    • Analyze the atpI promoter region for stress-responsive elements

    • Perform chromatin immunoprecipitation to identify transcription factors

    • Use reporter gene constructs to validate regulatory mechanisms

  • Transgenic approach:

    • Express S. bulbocastanum atpI in cultivated potato

    • Evaluate changes in stress tolerance

    • Identify specific domains or residues contributing to stress adaptation

Evidence suggests that ATP synthase modulation represents an important feedback regulatory mechanism that adjusts to metabolic status and various stress conditions, including drought . The unique adaptations in S. bulbocastanum atpI could potentially be transferred to cultivated species to enhance stress resilience.

How can I troubleshoot poor expression of recombinant atpI?

Membrane proteins like atpI are notoriously challenging to express. Here are systematic approaches to overcome common issues:

  • Expression vector optimization:

    StrategyImplementationExpected Outcome
    Codon optimizationAdjust codon usage to match expression host2-5 fold increase in expression
    Fusion partnersTest MBP, SUMO, or Mistic fusionsImproved solubility and membrane insertion
    Promoter selectionCompare T7, trc, and arabinose-inducible systemsIdentify optimal expression level
    Signal sequenceInclude or modify native chloroplast signalProper membrane targeting
  • Expression conditions optimization:

    • Reduce induction temperature to 16-20°C

    • Test various induction times and inducer concentrations

    • Supplement media with specific lipids to support membrane protein folding

    • Evaluate different cell lines specifically engineered for membrane protein expression

  • Protein toxicity mitigation:

    • Use tight promoter control to prevent leaky expression

    • Consider cell-free expression systems

    • Test dual-plasmid systems where toxic elements are separated

When expressing chloroplast proteins, incorporating chloroplast-specific chaperones can significantly improve proper folding and yield .

What are the best approaches for studying atpI interactions with lipids?

The lipid environment is crucial for ATP synthase function, with specific lipid-protein interactions potentially playing key roles:

  • Lipid binding site identification:

    • Use photoactivatable lipid analogs for crosslinking

    • Perform molecular dynamics simulations to predict binding pockets

    • Apply hydrogen-deuterium exchange mass spectrometry to identify protected regions

  • Functional impact assessment:

    TechniqueApplicationInformation Gained
    Reconstitution in nanodiscsDefined lipid compositionSpecific lipid requirements
    GUV-based assaysControlled membrane curvaturePhysical membrane effects
    Native mass spectrometryDetergent-free analysisStoichiometry of bound lipids
  • Lipid specificity determination:

    • Compare activity in different defined lipid environments

    • Assess binding affinities for different lipid species

    • Identify lipid-sensing domains through mutagenesis

The thylakoid membrane has a unique lipid composition, and specific lipids may be required for proper atpI folding and function, similar to requirements observed for other membrane protein complexes in chloroplasts.

How can I develop specific antibodies against S. bulbocastanum atpI?

Generating high-quality antibodies against membrane proteins requires careful antigen design:

  • Epitope selection strategies:

    • Identify hydrophilic loops exposed to the stromal or lumenal side

    • Avoid transmembrane regions that are typically poorly immunogenic

    • Consider species-specific regions when cross-reactivity is a concern

  • Antigen preparation approaches:

    • Synthesize peptides corresponding to selected epitopes

    • Express and purify hydrophilic domains as recombinant proteins

    • Use multiple antigens to increase chances of success

  • Antibody validation framework:

    • Test against recombinant protein and native extracts

    • Perform immunoprecipitation to confirm specificity

    • Use genetic knockouts or knockdowns as negative controls

    • Evaluate cross-reactivity with related Solanum species

Raising antibodies against multiple epitopes increases the likelihood of obtaining reagents suitable for different applications (western blotting, immunolocalization, co-immunoprecipitation) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.