Recombinant Solanum bulbocastanum Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Solanum bulbocastanum (Wild potato)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLFYLASIVFLPWWISFSVNKCLESWVTNWWNTGQSQIVLNNIQEKSLLEKF RELEELLFLDEMIKEYSETHLEEFGIGIHKETIQLITIQNENRMDTILHFSTNIIWFGIL SGYSILGKEKLVILNSWAQEFLYNLSDTAKALCLLLVTEFFLGYHSPPGWEFAIRSIYNE VGVVANEQTITILVCILPVIFDTCFKYWLFRYLTSLSPSILLIYDSITE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly facilitates efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is cemA and what is its function in Solanum bulbocastanum?

cemA (also known as ycf10) is a chloroplast envelope membrane protein encoded by the chloroplast genome in Solanum bulbocastanum. While its precise function remains under investigation, comparative studies with homologs in other species suggest it plays critical roles in chloroplast function, potentially involving CO2 uptake, ion transport, or membrane integrity maintenance. The protein is characterized as a membrane-embedded transporter with multiple transmembrane domains, consistent with its localization in the chloroplast envelope membrane . Unlike many nuclear-encoded chloroplast proteins, cemA is chloroplast-encoded, which has significant implications for its expression regulation and evolutionary conservation.

How does cemA compare between Solanum bulbocastanum and other species?

Comparative analysis between Solanum bulbocastanum cemA and its rice (Oryza sativa) homolog reveals both conservation and divergence. The rice cemA protein consists of 230 amino acids compared to 229 in S. bulbocastanum . Both proteins share characteristic N-terminal features including a lysine-rich region, suggesting evolutionary conservation of certain functional domains. Sequence alignment shows:

FeatureS. bulbocastanum cemAO. sativa cemA
Length229 amino acids230 amino acids
N-terminusMAKKKAFT...MKKKKALPS...
Signal sequencePresentPresent
Transmembrane domainsMultiple predictedMultiple predicted
UniProt IDQ2MIH5P0C302

The highest conservation appears in the N-terminal region and predicted transmembrane domains, suggesting functional significance of these regions .

What protocols are effective for isolating chloroplast envelope proteins from Solanum bulbocastanum?

Isolation of chloroplast envelope proteins, including cemA, from Solanum bulbocastanum requires a multi-step fractionation approach:

  • Intact chloroplast isolation: Utilize density gradient centrifugation on Percoll gradients as described by Halperin et al. (2001) . This critical first step requires careful tissue homogenization and gradient preparation to maintain chloroplast integrity.

  • Envelope membrane separation: Subject isolated chloroplasts to osmotic shock followed by sonication to release the envelope membranes . This can be performed as follows:

    • Resuspend purified chloroplasts in hypotonic buffer (10 mM HEPES-KOH, pH 7.6)

    • Apply controlled sonication (typically 3-5 short bursts)

    • Fractionate membranes by centrifugation on sucrose gradients (typically 0.46-1.0 M sucrose)

  • Protein extraction: For membrane proteins like cemA, use non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) at 1.0% (w/v) to solubilize the protein while maintaining native conformation . Always include protease inhibitor cocktails during extraction to prevent degradation.

Verification of fraction purity should employ immunoblotting with antibodies against compartment-specific marker proteins: OE33 for thylakoids, RbcL for stroma, and OEP24 for envelopes .

What expression systems are optimal for producing recombinant cemA?

The optimal expression system for recombinant S. bulbocastanum cemA depends on research objectives:

Selection of the appropriate system should consider the requirements for protein folding, post-translational modifications, and downstream applications.

How can protein-protein interactions involving cemA be studied?

Several complementary approaches can be employed to investigate cemA interactions:

  • Affinity enrichment approach: As demonstrated for other chloroplast membrane proteins, this technique involves:

    • Expressing tagged cemA (e.g., HA-tagged)

    • Solubilizing membranes with mild detergents (e.g., β-dodecyl maltoside)

    • Performing pull-down with anti-tag antibodies

    • Analyzing associated proteins by MS with statistical analysis to distinguish true interactors from background

  • Affinity purification with controlled washing: For stronger interactions, more stringent washing can be employed, followed by specific elution using tag-competing peptides (e.g., HA peptide) :

    • This approach identified CPN60 interaction with another chloroplast membrane protein (FTSH11)

    • It allows differentiation between stable and transient interactions

  • In vivo proximity labeling: Using BioID or APEX2 fused to cemA to label proteins in close proximity in their native environment.

  • Comparative analysis under different conditions: Studying interaction networks under different physiological conditions (e.g., temperature stress) can reveal condition-specific interactions .

How can genome editing techniques be applied to study cemA function in Solanum bulbocastanum?

Recent advances in genome editing of Solanum species can be adapted to study cemA function:

  • Protoplast-based editing approach: Building on methods developed for S. bulbocastanum :

    • Optimize protoplast isolation protocol specifically for S. bulbocastanum leaf tissue

    • Adjust macerozyme concentration to account for the thicker, more robust leaf structure compared to S. tuberosum

    • Use ribonucleoprotein (RNP) complexes consisting of Cas9 and sgRNA assembled in vitro

    • Design sgRNAs targeting cemA regions with high target score efficiency

  • Efficiency considerations: Based on similar approaches, expect gene-editing efficiency in the protoplast pool between 8.5% and 12.4% . Higher efficiency might be achieved by:

    • Multiple transfection rounds

    • Optimizing protoplast viability

    • Testing multiple sgRNAs (at least 4 recommended)

  • Regeneration protocol: Following transformation, implement:

    • Culture of individual protoplasts to develop microcalli

    • Selection and regeneration of plants from these microcalli

    • Screening for desired mutations (typically deletions of 2-8 bp)

  • Mutation confirmation: Verify edited plants using:

    • PCR amplification of target regions

    • Sequencing to confirm mutations

    • Analysis of homozygous vs. heterozygous edits

This approach enables generation of transgene-free plants with precise mutations in cemA for functional studies.

What methods are most effective for studying cemA localization?

A multi-faceted approach to cemA localization should include:

  • Subcellular fractionation and immunoblotting:

    • Isolate organelles (chloroplasts, mitochondria) by density gradient centrifugation

    • Further fractionate chloroplasts into membrane and soluble fractions

    • Separate thylakoid and envelope membranes using sucrose gradients

    • Perform immunoblot analysis with cemA-specific antibodies and control antibodies for marker proteins

  • Fluorescent protein fusion approaches:

    • Create C-terminal and N-terminal fluorescent protein fusions (considering tag interference with signal peptides)

    • Transiently express in plant cells or protoplasts

    • Visualize using confocal microscopy with appropriate chloroplast markers

  • Immunogold electron microscopy:

    • For highest resolution localization within the chloroplast envelope

    • Requires specific antibodies against cemA or tags

    • Allows precise membrane location (inner vs. outer envelope)

These methods should be used complementarily, as each provides different resolution and context information.

What are common challenges in recombinant cemA production and how can they be overcome?

Researchers face several challenges when working with recombinant cemA:

  • Protein solubility and folding issues:

    • Challenge: As a membrane protein, cemA tends to aggregate when overexpressed

    • Solution: Express at lower temperatures (16-18°C), use specialized E. coli strains, and include membrane-mimetic environments (detergents, lipids)

    • Consider adding stabilizing agents such as glycerol (50%) in storage buffers

  • Purification complications:

    • Challenge: Maintaining protein stability during extraction and purification

    • Solution: Use gentle detergents (DDM at 1.0%) and include protease inhibitor cocktails

    • Optimize buffer conditions (pH, salt concentration) for each purification step

  • Functional verification:

    • Challenge: Confirming proper folding and function of recombinant cemA

    • Solution: Develop activity assays based on predicted functions (e.g., transport assays)

    • Compare structural characteristics with native protein using circular dichroism or limited proteolysis

  • Storage stability:

    • Challenge: Maintaining protein integrity during storage

    • Solution: Store in Tris-based buffer with 50% glycerol at -20°C or -80°C

    • Avoid repeated freeze-thaw cycles by preparing working aliquots stored at 4°C for up to one week

How can researchers assess the quality and functionality of recombinant cemA?

Quality assessment of recombinant cemA should include:

What are promising research avenues for cemA in Solanum bulbocastanum?

Several promising directions for cemA research include:

  • Structural biology approaches: Applying cryo-electron microscopy or X-ray crystallography to determine the high-resolution structure of cemA, which would provide insights into its molecular function.

  • Interactome mapping: Comprehensive identification of cemA interaction partners under different physiological conditions could reveal condition-specific functions and regulatory mechanisms.

  • Comparative functional analysis: Exploring functional differences between cemA from Solanum bulbocastanum and other species could provide insights into species-specific adaptations.

  • Integration with crop improvement: Understanding cemA's role in photosynthesis and stress responses could contribute to strategies for improving wild potato relatives for agricultural applications.

  • Evolution and conservation studies: Analyzing the evolutionary conservation of cemA across Solanum species could provide insights into its fundamental importance for chloroplast function.

These research directions would significantly advance our understanding of this important chloroplast envelope protein and potentially contribute to broader applications in plant biology and agriculture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.