Recombinant Solanum bulbocastanum Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Solanum bulbocastanum Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Solanum bulbocastanum Cytochrome b6-f complex subunit 4 (petD) is a genetically engineered form of the petD subunit of the cytochrome b6-f complex, derived from Solanum bulbocastanum (wild potato) . The cytochrome b6-f complex is an enzyme found in the thylakoid membranes of chloroplasts in plants, cyanobacteria, and green algae . It plays a crucial role in photosynthesis by mediating the transfer of electrons between Photosystem II and Photosystem I, and also contributes to the generation of a proton gradient that drives ATP synthesis .

Structure and Function of Cytochrome b6-f Complex Subunit 4 (petD)

The petD subunit, also known as subunit IV, is a component of the cytochrome b6-f complex . In Solanum lycopersicum, the full-length petD protein consists of 160 amino acids . The molecular weight of subunit IV is approximately 17 kDa . The petD subunit participates in the electron transfer process within the cytochrome b6-f complex . Specifically, it is involved in the binding of plastoquinol and plastoquinone, which are essential components of the electron transport chain .

Production of Recombinant petD Protein

Recombinant petD protein is produced using genetic engineering techniques, where the gene encoding petD is inserted into a host organism (e.g., E. coli) for expression . For example, a recombinant full-length Solanum lycopersicum Cytochrome b6-f complex subunit 4(petD) Protein, His-Tagged, is expressed in E. coli . The recombinant protein often includes a His-tag, which facilitates purification using affinity chromatography .

Role in Photosynthesis

The cytochrome b6-f complex, including the petD subunit, is essential for photosynthesis . It facilitates the transfer of electrons from Photosystem II to Photosystem I . This electron transfer is coupled with the pumping of protons across the thylakoid membrane, creating an electrochemical gradient . This gradient is then used by ATP synthase to produce ATP, the energy currency of the cell .

Experimental Evidence and Research Findings

Trypsinolysis experiments have demonstrated the catalytic role of subunit IV in the chloroplast cytochrome b6-f complex . The activity of the cytochrome b6-f complex decreases as the incubation time with trypsin increases, with a maximal inactivation of 80% reached at 7 minutes of incubation . The inactivation is accompanied by the destruction of the proton translocation activity of the complex, and subunit IV is the only subunit digested by trypsin .

Applications of Recombinant petD

Recombinant petD protein can be used in various biochemical and biophysical studies, including:

  • Enzyme Activity Assays: Studying the electron transfer activity of the cytochrome b6-f complex .

  • Structural Studies: Determining the three-dimensional structure of the complex using X-ray crystallography or cryo-electron microscopy.

  • Antibody Production: Generating antibodies against the petD subunit for use in Western blotting and immunolocalization studies .

Data Table: Properties of Recombinant Solanum lycopersicum petD Protein

PropertyDescription
SourceSolanum lycopersicum (Tomato)
Gene InformationpetD
Protein NamesCytochrome b6-f complex subunit 4
Expression Region1-160
Host OrganismE. coli
TagN-terminal His tag
Molecular Weight~17 kDa
FunctionComponent of the cytochrome b6-f complex, involved in electron transfer and proton translocation
Storage BufferTris-based buffer, 50% glycerol
Storage Temperature-20℃, for extended storage, conserve at -20℃ or -80℃

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Solanum bulbocastanum (Wild potato)
Target Names
petD
Target Protein Sequence
MGITKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does the petD gene play?

The cytochrome b6-f complex plays a critical role in electron transfer within the thylakoid membrane. The petD gene specifically encodes subunit IV of this complex. Research indicates that subunit IV is essential for the assembly and function of the entire complex, with its absence resulting in decreased synthesis of cytochrome f. In petD deletion mutants (ΔpetD), the rate of cytochrome f synthesis is significantly reduced, demonstrating the interdependence of these components . The 17.4-kDa subunit IV encoded by petD has shown slight variations in migration profiles during electrophoresis when carrying point mutations, suggesting structural sensitivity to even minor amino acid changes .

How does Solanum bulbocastanum differ from cultivated potato in cellular structure?

Solanum bulbocastanum, a wild diploid tuber-bearing plant, possesses distinctive morphological characteristics that affect experimental protocols. Notably, S. bulbocastanum leaves are thicker, larger, and more robust compared to Solanum tuberosum (cultivated potato) . These structural differences significantly impact laboratory procedures, particularly protoplast isolation, where protocols developed for S. tuberosum yield insufficient numbers of intact viable protoplasts when applied to S. bulbocastanum. Microscopic examination revealed burst protoplasts with cell wall debris, indicating incomplete digestion under standard protocols and necessitating species-specific optimization .

Why is Solanum bulbocastanum significant in molecular breeding research?

S. bulbocastanum has garnered significant scientific interest as a valuable source of disease resistance genes. This wild potato species harbors multiple resistance genes against devastating pathogens, including Phytophthora infestans (late blight) and Columbia root-knot nematode (CRKN) . Several important resistance genes have been successfully mapped and introgressed into potato germplasm, including Rpi-blb3, which belongs to a major late blight R gene cluster on chromosome 4 . The genome sequencing of S. bulbocastanum selection SB22 has expanded knowledge of resistance mechanisms and provides resources for addressing emerging races of pests and pathogens .

How do mutations in the petD gene affect cytochrome b6-f complex assembly and function?

The petD gene is essential for cytochrome b6-f complex formation, with complete deletion (ΔpetD) severely impacting cytochrome f accumulation . Different point mutations in subunit IV produce varying phenotypes. Research has shown that complemented strains with modified petD sequences can restore complex formation, though the migration profiles of the 17.4-kDa subunit IV may show subtle differences in peptide mobility induced by single-point mutations . In petD RM and SD mutants, accumulation of subunit IV and cytochrome f was comparable to wild-type levels, demonstrating that certain mutations can maintain proper assembly . These findings highlight the structural flexibility of subunit IV while maintaining its essential functions.

What are the challenges in optimizing transformation protocols for Solanum bulbocastanum?

Transformation of S. bulbocastanum presents unique challenges compared to cultivated potato due to its distinctive cellular characteristics. When protocols developed for S. tuberosum were initially applied to S. bulbocastanum, researchers observed insufficient numbers of intact viable protoplasts . Microscopic examination revealed a high prevalence of burst protoplasts showing traces of cell wall debris, indicating incomplete cell wall digestion . This necessitated optimization of enzyme concentrations, particularly macerozyme, to accommodate the thicker, more robust leaves of S. bulbocastanum. These adaptations highlight the importance of species-specific protocol optimization when working with wild Solanum species.

How can CRISPR-Cas9 genome editing be optimized for Solanum bulbocastanum?

Successful genome editing of S. bulbocastanum can be achieved using ribonucleoproteins (RNPs) consisting of Cas9 enzyme and sgRNA assembled in vitro. This transgene-free approach has yielded gene editing efficiencies between 8.5% and 12.4% in protoplast pools . Key methodological considerations include:

  • Design of effective sgRNAs (four different sgRNAs were tested in the referenced study)

  • Optimization of protoplast isolation protocols specifically for S. bulbocastanum

  • Regeneration of plants from microcalli developed from individual protoplasts

  • Verification of editing events in regenerated plants

In experimental outcomes, twenty-one plants were regenerated from microcalli, with three plants showing successful target gene editing. Two edited plants had deletion mutations in both alleles, while one had a mutation in only one allele .

What methods can be used to measure electron transfer through the cytochrome b6-f complex?

Electron transfer through the cytochrome b6-f complex can be precisely measured using spectroscopic techniques. The transmembrane electrogenic phase of electron transfer between hemes bL and bH (occurring after quinol oxidation at the Qo site) can be quantified as an electrochromic shift of carotenoids, which produces a measurable absorbance increase at 520 nm . This approach allows researchers to assess the functional impact of mutations in cytochrome b6-f complex components, including those in the petD-encoded subunit IV. Using this methodology, researchers have determined that mutations at positions Asn122Leu, Tyr124Lys, and Arg125Glu result in electron transfer rates very similar to wild type .

What techniques are effective for isolating intact viable protoplasts from Solanum bulbocastanum?

Isolation of viable protoplasts from S. bulbocastanum requires modification of standard protocols used for cultivated potato. Due to the thicker, larger, and more robust leaves of S. bulbocastanum, standard enzymatic digestion protocols often result in incomplete cell wall digestion . Key modifications include:

  • Optimization of macerozyme concentration to achieve complete cell wall digestion

  • Adjustment of incubation times to account for the thicker leaf structure

  • Careful microscopic monitoring of protoplast integrity during isolation

A successfully optimized protocol enables the isolation of sufficient quantities of intact viable protoplasts for downstream applications such as transformation with CRISPR-Cas9 ribonucleoproteins .

How is recombinant cytochrome b6-f complex subunit IV being utilized in functional studies?

Recombinant cytochrome b6-f complex components are valuable tools for dissecting structure-function relationships. In vitro reconstitution experiments with purified cytochrome b6-f and recombinant kinase domains have demonstrated that the complex can enhance kinase autophosphorylation activities . This approach allows researchers to identify specific regions of subunit IV involved in protein-protein interactions and signal transduction. Studies examining specific amino acid substitutions (Asn122Leu, Tyr124Lys, and Arg125Glu) have provided insights into regions that may or may not affect electron transfer functions . These experimental systems offer powerful approaches for understanding how structural modifications impact both assembly and function.

What genomic resources are available for studying gene function in Solanum bulbocastanum?

Recent advances in S. bulbocastanum genomics have expanded the resources available for functional studies. The SB22 genome sequencing project has provided valuable genomic data for understanding resistance mechanisms and identifying novel resistance genes . This genomic resource facilitates the discovery of genes responsible for disease resistance, enabling breeders to predictably and rapidly introgress these genes into elite cultivars through molecular approaches. The identification of resistance gene analogs, particularly TNL genes in proximity to CRKN resistance markers, provides targets for functional validation . Future improvements to this genomic resource may incorporate technologies like PacBio HiFi sequencing, tissue-specific RNAseq data, and more accurate R-gene prediction models .

How does the evolutionary conservation of petD compare across Solanum species?

The petD gene and its encoded cytochrome b6-f complex subunit IV show evolutionary conservation across Solanum species, reflecting their essential role in photosynthetic electron transport. Comparative genomic analyses have revealed that while core functional domains are conserved, specific regions may vary between species. These variations may contribute to species-specific adaptations in photosynthetic efficiency under different environmental conditions. The successful application of S. tuberosum transformation protocols to S. bulbocastanum, albeit with necessary modifications, suggests structural and functional homology between the species . Further studies comparing sequence conservation and functional properties of petD across wild and cultivated Solanum species would enhance our understanding of evolutionary constraints on this essential photosynthetic component.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.