Recombinant Solanum bulbocastanum Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

Expression Systems

  • Host: Mammalian cells (e.g., HEK293) for proper folding and post-translational modifications .

  • Tag: His-tag fused to the N-terminus for affinity chromatography .

Purification Protocol

  1. Solubilization: Use of mild detergents (e.g., DDM) to extract the protein from membranes .

  2. Chromatography: Ni-NTA affinity purification followed by size-exclusion chromatography .

  3. Storage: Lyophilized powder in Tris buffer with 50% glycerol; stable at -80°C for 12 months .

Role in Photosynthesis

  • Electron Transport: Facilitates plastoquinol oxidation and proton gradient generation via the Q-cycle mechanism .

  • Regulatory Role: The C-terminus interacts with the STT7 kinase to regulate light-harvesting complex II (LHCII) phosphorylation, optimizing PSI/PSII balance .

Comparative Analysis

FeatureS. bulbocastanum PetBChlamydomonas PetB
Heme cnAbsent Present
STT7 InteractionConfirmed Not observed
AssemblyRequires PetD subunitRequires PetG/L/X

Research Applications

  • Antibody Development: Used as an immunogen for polyclonal antibodies targeting Cyt b6/f complexes (e.g., Agrisera AS18 4169) .

  • Structural Studies: Crystallization trials to resolve electron transport mechanisms .

  • Mutagenesis: Site-directed mutations (e.g., R207K) to probe heme-propionate interactions .

Challenges and Future Directions

  • Stability Issues: Truncations at L215 or extensions (e.g., G216) disrupt heme ci binding, necessitating FTSH protease knockout for accumulation .

  • Biotechnological Potential: Engineering PetB variants to enhance photosynthetic efficiency in crops .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
petB; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Solanum bulbocastanum (Wild potato)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIADDITSKYVPPHVNIFYCLGGITLTCFLVQVATGFAMTFYYRP TVTEAFASVQYIMTEANFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVT GVVLAVLTASFGVTGYSLPWDQIGYWAVKIVTGVPDAIPVIGSPLVELLRGSASVGQSTL TRFYSLHTFVLPLLTAVFMLMHFPMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 (petB) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitating cyclic electron flow around PSI, and contributing to state transitions.
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and size of the cytochrome b6 (petB) gene in Solanum bulbocastanum?

The petB gene in S. bulbocastanum is part of the cytochrome B6/F complex encoded in the chloroplast genome (plastome). It is the longest gene among the cytochrome B6/F genes with a total length of 1401 bp including its intronic region . The gene contains a single intron, which is a characteristic feature of chloroplast petB genes across the Solanaceae family . The gene's exon regions encode the functional protein that forms part of the cytochrome b6/f complex involved in photosynthetic electron transport.

How does the petB gene in S. bulbocastanum compare to other Solanaceae species?

The petB gene structure is largely conserved across the Solanaceae family. Comparative genomic analyses of seven Solanaceae species revealed that the number of cytochrome B6/F genes (six in total) is constant across the family . While some genes in S. bulbocastanum show length variations (such as the psbC gene being slightly longer at 1422 bp), the petB gene maintains consistent structural features across the family . This conservation suggests important functional constraints on this gene's evolution in the Solanaceae family.

What is the relationship between petB and the RB resistance gene in S. bulbocastanum?

While both genes are present in S. bulbocastanum, they serve different functions and are located in different cellular compartments. The petB gene is encoded in the chloroplast genome and functions in photosynthesis . In contrast, the RB gene is a nuclear-encoded resistance gene belonging to the CC-NBS-LRR class that confers broad-spectrum resistance to late blight disease caused by Phytophthora infestans . The RB gene was mapped to chromosome 8 of S. bulbocastanum and functions in pathogen recognition and defense response activation . These genes represent different aspects of plant biology—petB in primary metabolism (photosynthesis) and RB in plant defense.

What are the recommended protocols for isolating and amplifying the petB gene from S. bulbocastanum?

For isolating the petB gene from S. bulbocastanum, researchers should follow these methodological steps:

  • Chloroplast DNA Isolation: Use a modified CTAB (cetyltrimethylammonium bromide) method optimized for Solanaceae species.

  • PCR Amplification: Design primers flanking the entire petB gene region (including introns). Based on the research data, the primers should span approximately 1401 bp .

  • Long-Range PCR Approach: Similar to the technique used for the RB gene, a long-range PCR strategy is recommended for intact gene amplification . Use high-fidelity polymerase with proofreading capability.

  • Verification: Confirm amplicon identity through restriction enzyme digestion patterns or end sequencing.

For cloning purposes, the amplified product can be inserted into suitable vectors (such as pGEM-T or pCR-XL-TOPO) as demonstrated in similar studies with other S. bulbocastanum genes .

How can researchers effectively conduct RNA editing analysis of the petB transcript?

RNA editing is an important post-transcriptional modification in chloroplast genes. To study RNA editing in petB:

  • RNA Isolation: Extract total RNA from leaf tissue using TRIzol or similar reagents, followed by poly(A)+ RNA isolation if necessary .

  • RT-PCR: Perform reverse transcription followed by PCR using petB-specific primers.

  • Comparative Analysis: Sequence both genomic DNA and cDNA versions of petB to identify C-to-U editing sites.

  • Timing Considerations: Collect samples at different developmental stages or under different environmental conditions, as RNA editing can be regulated by these factors.

  • Quantification: Use methods like high-resolution melting analysis or pyrosequencing to quantify editing efficiency at specific sites.

Similar to other plastid genes in Solanaceae that undergo RNA editing (like psbL mentioned in the research), the petB transcripts should be carefully analyzed for potential editing sites that might affect protein function .

What expression systems are most suitable for producing recombinant S. bulbocastanum cytochrome b6 protein?

For expressing recombinant cytochrome b6 protein from S. bulbocastanum:

The choice of expression system should be guided by the research objectives—structural studies might require high yields from bacterial systems, while functional studies might necessitate expression in chloroplast-based systems.

How does the structure of the petB intron in S. bulbocastanum compare to other species, and what are the implications for splicing mechanisms?

The petB intron in S. bulbocastanum and other Solanaceae species shows conserved boundary sequences. The 5' splice site begins with GTGTGACTT and the 3' splice site ends with TATCTCAAT . This conservation suggests important functional constraints on intron processing.

Gene with Intron5' Splice Site3' Splice Site
petBGTGTGACTTTATCTCAAT
petDGTGTGACTTTATCCCAAT
atpFGTGCGAGTTTACTTTCAT
rpoC1GTGTGATTTTATCCCAAT

The similarity in splice site sequences among different chloroplast genes suggests common splicing machinery involvement . For researchers, this has several implications:

  • The conservation indicates potential shared regulatory mechanisms for processing these transcripts.

  • Any mutations in these sites could affect multiple chloroplast genes simultaneously.

  • Comparative studies across species could reveal evolutionary patterns in chloroplast intron processing.

Advanced research should focus on the secondary structure of the intron and its role in self-splicing or protein-assisted splicing mechanisms.

What is known about the post-translational modifications of cytochrome b6 in S. bulbocastanum and how do they affect protein function?

Cytochrome b6 undergoes several important post-translational modifications that are likely conserved in S. bulbocastanum:

  • Heme Attachment: Two b-type hemes (non-covalently bound) and one covalently bound c-type heme (heme ci) are incorporated.

  • Disulfide Bond Formation: Critical for structural stability and electron transfer function.

  • N-terminal Processing: Removal of transit peptide upon chloroplast import.

These modifications are essential for the protein's function in the electron transport chain. Unlike many other cytochrome proteins, the unique covalent attachment of heme ci is particularly important for research focus, as it represents an unusual feature of cytochrome b6. While specific data for S. bulbocastanum modifications is limited, the conserved nature of the cytochrome b6/f complex across plants suggests similar modification patterns to other well-studied species.

How can gene editing technologies be applied to study petB function in S. bulbocastanum?

For investigating petB function using gene editing approaches:

  • Chloroplast Transformation:

    • Utilize biolistic transformation with homologous recombination constructs

    • Target specific regions of petB to introduce point mutations or deletions

    • Select transformants using spectinomycin resistance markers

  • CRISPR-Cas9 Applications:

    • While direct editing of chloroplast genes with CRISPR is challenging, indirect approaches include:

    • Targeting nuclear-encoded factors that regulate petB expression

    • Modifying nuclear genes involved in petB RNA processing or protein assembly

  • Methodological Considerations:

    • Develop tissue culture protocols specific for S. bulbocastanum

    • Optimize transformation conditions based on protocols used for other Solanaceae species

    • Implement screening techniques to identify successful transformants

  • Phenotypic Analysis:

    • Examine photosynthetic efficiency using chlorophyll fluorescence

    • Measure electron transport rates

    • Assess plant growth and development under various light conditions

How has the petB gene evolved within the Solanum genus, and what does this tell us about evolutionary selection pressures?

The petB gene shows remarkable conservation across the Solanaceae family, including within the Solanum genus . This high degree of sequence conservation is typical of chloroplast genes and suggests strong purifying selection. Despite this conservation, careful comparative analysis can reveal important evolutionary insights:

  • Synonymous vs. Non-synonymous Substitutions: Calculate the ratio of these substitution types to determine selection pressure intensity.

  • Intron Evolution: Compare intron sequences which may evolve more rapidly than exons.

  • RNA Editing Sites: Examine conservation of RNA editing sites, which represent another layer of evolutionary adaptation.

Researchers interested in petB evolution should perform phylogenetic analyses incorporating sequence data from diverse Solanum species, including cultivated and wild species. Such analyses could reveal whether domestication has influenced petB evolution in cultivated potato compared to wild species like S. bulbocastanum.

What is the relationship between cytochrome b6 sequence variation and photosynthetic efficiency in different S. bulbocastanum accessions?

This question addresses an important aspect of functional genomics. Researchers should consider:

  • Accession Screening: Collect and sequence the petB gene from multiple S. bulbocastanum accessions from different geographical regions.

  • Photosynthetic Measurements:

    • Measure photosystem II efficiency (Fv/Fm ratio)

    • Determine electron transport rates

    • Assess carbon assimilation rates

    • Measure growth parameters under different light intensities

  • Correlation Analysis: Perform statistical analysis to identify associations between sequence polymorphisms and functional parameters.

A comprehensive study would combine sequence analysis with protein modeling to predict how amino acid substitutions might affect protein function, followed by experimental validation through recombinant protein studies or transgenic complementation.

How can knowledge of the petB gene contribute to improving photosynthetic efficiency in potato breeding programs?

The petB gene represents a potential target for improving photosynthetic efficiency in potato. Researchers can pursue several approaches:

  • Allele Mining: Screen diverse Solanum germplasm (including S. bulbocastanum) for natural petB variants with potential benefits for photosynthetic performance.

  • Marker Development: Develop molecular markers linked to beneficial petB alleles for marker-assisted selection.

  • Transgenic Approaches: Similar to the successful use of the RB gene from S. bulbocastanum for disease resistance , engineer improved petB variants into cultivated potato.

  • Chloroplast Transformation: Directly modify the petB gene in the chloroplast genome of cultivated potato using organelle transformation techniques.

The integration of wild species genes into cultivated potato has proven successful for disease resistance (as demonstrated with the RB gene) , suggesting similar approaches could be valuable for improving other traits, including photosynthetic efficiency through petB modification.

What is the current understanding of how cytochrome b6 interacts with other proteins in the photosynthetic electron transport chain of S. bulbocastanum?

Cytochrome b6 functions as part of the multisubunit cytochrome b6/f complex, which plays a central role in photosynthetic electron transport. In S. bulbocastanum, as in other plants, this complex likely consists of four major subunits (cytochrome b6, cytochrome f, subunit IV, and the Rieske iron-sulfur protein) and four minor subunits.

Key protein-protein interactions include:

  • Internal Complex Interactions:

    • Interaction between petB (cytochrome b6) and petA (cytochrome f)

    • Association with small subunits petG, petL, petM, and petN

  • External Interactions:

    • Plastoquinol binding and oxidation

    • Plastocyanin interaction for electron transfer

    • Potential interactions with photosystem I and II proteins

For researchers studying these interactions, techniques such as blue native PAGE, co-immunoprecipitation, and structural biology approaches (X-ray crystallography or cryo-EM) would be valuable. Knowledge of these interactions could inform genetic engineering strategies to optimize electron transport efficiency.

What are the most common challenges in expressing and purifying recombinant cytochrome b6 protein, and how can they be overcome?

Expressing and purifying functional cytochrome b6 presents several challenges:

  • Membrane Protein Solubility:

    • Challenge: As an integral membrane protein, cytochrome b6 is highly hydrophobic

    • Solution: Use specialized detergents (n-dodecyl β-D-maltoside, digitonin) for solubilization; consider fusion with solubility-enhancing tags

  • Cofactor Incorporation:

    • Challenge: Proper incorporation of heme groups

    • Solution: Co-express with heme biosynthesis genes; supplement growth media with δ-aminolevulinic acid

  • Protein Folding:

    • Challenge: Achieving correct folding in heterologous systems

    • Solution: Express at lower temperatures (16-20°C); use specialized E. coli strains (C41/C43); consider chloroplast-based expression systems

  • Functional Assessment:

    • Challenge: Verifying that purified protein maintains native activity

    • Solution: Develop spectroscopic assays for heme incorporation; assess electron transfer capability using artificial electron donors/acceptors

A systematic approach addressing each of these challenges sequentially is recommended for successful recombinant cytochrome b6 production.

How can researchers effectively analyze the impact of petB mutations on protein function and photosynthetic efficiency?

A comprehensive approach to analyzing petB mutations includes:

  • In Silico Analysis:

    • Protein modeling based on known cytochrome b6 structures

    • Molecular dynamics simulations to predict effects on protein stability and function

    • Conservation analysis across species to identify functionally critical residues

  • In Vitro Functional Assays:

    • Recombinant protein production with introduced mutations

    • Spectroscopic analysis of heme incorporation and redox properties

    • Electron transfer assays using artificial electron donors/acceptors

  • In Vivo Studies:

    • Chloroplast transformation to introduce mutations

    • Chlorophyll fluorescence measurements to assess photosystem II efficiency

    • P700 absorbance measurements to evaluate photosystem I function

    • Growth analysis under various light conditions

  • Data Integration:

    • Correlate molecular-level changes with physiological impacts

    • Develop predictive models relating sequence variations to functional outcomes

This multilevel approach provides comprehensive insights into structure-function relationships in petB.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.