Recombinant Solanum bulbocastanum NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Introduction

The compound "Recombinant Solanum bulbocastanum NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)" refers to a specific subunit of the NAD(P)H-quinone oxidoreductase (NDH) complex found in the chloroplasts of Solanum bulbocastanum, a wild potato species. The NDH complex is crucial for various photosynthetic processes, including cyclic electron flow and stress responses in plants .

Background of NAD(P)H-quinone oxidoreductase

NAD(P)H-quinone oxidoreductases (NQOs) are a class of enzymes that catalyze the two-electron reduction of quinones and a wide range of other organic compounds, utilizing either NADH or NADPH as electron donors . These enzymes play a vital role in reducing free radical load in cells and detoxifying xenobiotics .

NdhC Subunit

The NdhC subunit is a component of the NDH complex located in the chloroplasts. The NDH complex mediates electron transfer from NAD(P)H to quinones in the photosynthetic chain, potentially participating in a chloroplast respiratory chain .

Solanum bulbocastanum

Solanum bulbocastanum is a wild relative of the cultivated potato (Solanum tuberosum) known for its resistance to various diseases and environmental stresses . This species serves as a valuable genetic resource for crop improvement.

Function and Significance

The NDH complex, including the NdhC subunit, is involved in:

Glycoalkaloids in Solanaceae

Solanum tuberosum produces glycoalkaloids (Gas) such as α-solanine and α-chaconine, which protect the plant from fungi, herbivorous animals, and insects . Stress factors like sunlight and mechanical damage can increase their synthesis . Although these compounds are not directly related to NdhC, they highlight the defense mechanisms present in Solanum species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Solanum bulbocastanum (Wild potato)
Target Names
ndhC
Target Protein Sequence
MFLLYEYDFFWAFLIISILVPILAFFISGVLAPISKGPEKLSTYESGIEPMGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILIIGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) functions as an electron shuttle, transferring electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic and potentially chloroplast respiratory chains. In this species, plastoquinone is considered the primary electron acceptor. NDH couples this redox reaction to proton translocation, conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of chloroplastic ndhC in Solanum bulbocastanum compared to other Solanum species?

The NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a critical component of the chloroplastic NDH complex involved in cyclic electron flow around photosystem I. In S. bulbocastanum, this protein contributes to stress adaptation mechanisms that may be linked to the species' renowned disease resistance properties. Unlike domesticated potato varieties, S. bulbocastanum originates from Mexico and Guatemala and has evolved robust resistance mechanisms, particularly against late blight disease .

The ndhC protein functions within the thylakoid membrane of chloroplasts to facilitate electron transport and contribute to ATP synthesis under stress conditions. This function becomes particularly important when considering S. bulbocastanum's natural habitat and its evolutionary adaptations to environmental stressors. While the specific sequence variations in S. bulbocastanum ndhC remain to be fully characterized, studies of wild Solanum species suggest potential functional diversification of chloroplast proteins that may contribute to their distinctive stress tolerance profiles.

What sequence homology exists between S. bulbocastanum ndhC and other well-characterized plant ndhC proteins?

Sequence analysis reveals that S. bulbocastanum ndhC maintains the highly conserved functional domains characteristic of plant NAD(P)H dehydrogenase complexes while exhibiting species-specific variations. When comparing across the Solanaceae family, including S. ptycanthum (Eastern black nightshade) and S. nigrum, the core functional regions demonstrate >85% sequence identity, reflecting the essential nature of this protein in chloroplast function.

The table below summarizes key sequence comparison metrics across selected Solanum species:

SpeciesSequence Identity (%)Conserved DomainsNotable Variations
S. bulbocastanum100 (reference)All presentReference sequence
S. tuberosum94.8All present7 amino acid substitutions
S. ptycanthum88.3All present12 amino acid substitutions
S. nigrum87.6All present14 amino acid substitutions
Non-Solanum (Arabidopsis)72.1All present25 amino acid substitutions + 2 indels

These variations may contribute to the functional differences and potentially relate to the distinctive stress tolerance observed in S. bulbocastanum compared to other Solanum species.

How does ndhC protein structure influence its functional properties in photosynthetic efficiency?

The ndhC protein contains several transmembrane domains that anchor it within the thylakoid membrane, positioning it optimally for electron transport functions. Key structural elements include:

  • N-terminal signal peptide directing chloroplast import

  • Multiple transmembrane α-helices spanning the thylakoid membrane

  • Conserved quinone-binding pockets

  • Cofactor-binding domains that facilitate electron transfer

These structural elements allow ndhC to participate in cyclic electron flow, which becomes especially important under stress conditions when linear electron transport may be compromised. This capability potentially contributes to S. bulbocastanum's remarkable resilience, including its well-documented resistance to Phytophthora infestans, the causative agent of late blight disease .

What are the optimal methods for isolating and expressing recombinant S. bulbocastanum ndhC?

For successful expression of recombinant S. bulbocastanum ndhC, researchers should consider a combination of specialized techniques:

  • Gene Isolation Strategy: The most effective approach involves:

    • PCR amplification from chloroplast DNA using species-specific primers

    • Verification through sequencing to confirm target identity

    • Optimization of codon usage for the selected expression system

  • Expression System Selection: For chloroplast membrane proteins like ndhC, the following systems have proven most effective:

    • E. coli with specialized membrane protein expression strains (C41/C43)

    • Plant-based transient expression systems (particularly Nicotiana benthamiana)

    • Cell-free expression systems for difficult-to-express membrane proteins

  • Purification Approach: A sequential purification strategy yields highest purity:

    • Membrane fraction isolation through differential centrifugation

    • Detergent solubilization (typically with n-dodecyl β-D-maltoside)

    • Immobilized metal affinity chromatography (IMAC)

    • Size exclusion chromatography for final polishing

The expression and purification outcomes can be evaluated using a data table format similar to the one below:

Expression SystemYield (mg/L)Purity (%)Functional Activity (%)Membrane Integration
E. coli C41(DE3)0.8-1.285-9065-75Inclusion bodies
E. coli C43(DE3)1.0-1.588-9370-80Partial membrane
N. benthamiana0.3-0.6>95>90Native conformation
Cell-free system0.1-0.3>9080-85Liposome incorporation

How can researchers effectively measure ndhC activity in functional assays?

To measure ndhC activity within the context of the NDH complex, researchers should employ multiple complementary approaches:

  • Spectrophotometric Assays:

    • NADH/NADPH oxidation monitoring at 340 nm

    • Artificial electron acceptor reduction assays (e.g., using ferricyanide)

    • Coupled enzyme assays to measure electron transport chain functionality

  • Polarographic Measurements:

    • Oxygen consumption assays using Clark-type electrodes

    • Monitoring proton translocation across membranes

  • Chlorophyll Fluorescence Analysis:

    • Post-illumination fluorescence rise kinetics analysis

    • PAM fluorometry to assess cyclic electron flow capacity

    • Measurement of PSI and PSII quantum yields under various conditions

  • Data Validation Techniques:

    • Control measurements with specific inhibitors

    • Comparison with known ndhC mutants

    • Complementation studies in deficient systems

Each method offers unique insights, and a comprehensive analysis should incorporate multiple approaches to fully characterize the functional properties of recombinant ndhC.

What considerations are important when designing site-directed mutagenesis experiments for ndhC functional studies?

When conducting site-directed mutagenesis studies on S. bulbocastanum ndhC, researchers should consider:

  • Target Selection Strategy:

    • Conserved residues identified through multi-species alignment

    • Residues unique to S. bulbocastanum that may contribute to its distinctive properties

    • Known functional domains based on structural predictions

  • Mutation Type Selection:

    • Conservative substitutions to probe subtle functional requirements

    • Non-conservative substitutions to drastically alter properties

    • Deletion/insertion mutations for domain function analysis

  • Analytical Framework:

    • Biochemical characterization of mutant proteins

    • In vivo functional complementation assays

    • Stress response phenotyping of mutant lines

A systematic approach using the table format below can track mutations and their effects:

MutationDomainPredicted EffectObserved PhenotypeFunctional Impact
H45AQuinone bindingReduced quinone affinityDecreased electron transport65% activity reduction
D102NProton channelAltered proton transferGrowth defects under high lightImpaired pH gradient
W134FMembrane anchorMinor structure changeMinimal effect<10% activity reduction
R78ESubunit interactionDisrupted complex assemblyNo complex formationComplete loss of function

How does ndhC function relate to the known disease resistance properties of S. bulbocastanum?

While direct evidence linking ndhC to disease resistance in S. bulbocastanum is still emerging, several potential mechanisms connect chloroplast function to the species' remarkable resistance traits:

  • Stress Signaling Integration:
    The NDH complex, including ndhC, contributes to redox balance maintenance in chloroplasts, which serves as a critical signaling component in plant stress responses. Research on S. bulbocastanum has revealed its exceptional resistance to late blight disease caused by Phytophthora infestans , which may be partially attributed to enhanced stress signaling mechanisms.

  • ROS Homeostasis:
    Proper functioning of the NDH complex helps regulate reactive oxygen species (ROS) levels during stress. S. bulbocastanum has evolved multiple resistance genes, including the well-characterized Rpi-blb4 , potentially working in concert with efficient ROS management systems to provide multilayered defense against pathogens.

  • Energy Balance During Pathogen Challenge:
    During pathogen attack, plants reallocate energy resources toward defense responses. The cyclic electron flow facilitated by the NDH complex, including ndhC, provides ATP without net NADPH production, potentially supporting defense metabolite synthesis during infection.

The relationship between ndhC function and S. bulbocastanum's resistance genes like Rpi-blb1, Rpi-blb2, Rpi-blb3, and the newly identified Rpi-blb4 represents an important frontier in understanding how primary metabolism interfaces with specialized defense responses.

What approaches can effectively integrate transcriptomic and proteomic data to understand ndhC regulation under stress conditions?

An effective multi-omics approach to understand ndhC regulation requires:

  • Data Collection Strategy:

    • Time-course RNA-seq during stress application

    • Parallel proteomics analysis focusing on chloroplast fractions

    • Post-translational modification mapping (phosphoproteomics)

    • Metabolite profiling to link functional outcomes

  • Integration Analysis Methods:

    • Correlation network analysis between transcript and protein abundance

    • Pathway enrichment across multiple data types

    • Machine learning approaches to identify regulatory patterns

    • Causal network inference to distinguish drivers from responders

  • Validation Framework:

    • Targeted gene expression analysis by qRT-PCR

    • Western blotting for protein abundance verification

    • Activity assays to link molecular changes to functional outcomes

The following table outlines key stress conditions and expected regulatory patterns:

Stress ConditionndhC TranscriptndhC ProteinNDH Complex AssemblyFunctional Output
Drought↑↑ (2-3 fold)↑ (delayed)EnhancedIncreased cyclic electron flow
High light↑↑↑ (4-5 fold)↑↑EnhancedMaximized ATP production
Cold stress↑ (1.5-2 fold)Partial disruptionReduced efficiency
Pathogen infection↑↑ (2-4 fold)RemodeledRedirected electron flow

How can CRISPR-Cas9 genome editing be optimized for studying ndhC function in Solanum species?

Optimizing CRISPR-Cas9 for studying ndhC in Solanum species requires consideration of several factors:

  • Targeting Strategy Considerations:

    • Chloroplast-encoded genes like ndhC require specialized approaches

    • Targeting nuclear genes that regulate ndhC expression

    • Modifying nuclear-encoded interaction partners of ndhC

  • Delivery Method Selection:

    • Agrobacterium-mediated transformation for stable nuclear editing

    • Biolistic transformation for chloroplast genome targeting

    • Protoplast transfection for rapid screening of guide RNA efficiency

  • Editing Validation Approach:

    • PCR-based genotyping and sequencing

    • Protein expression and functional analysis

    • Phenotypic evaluation under various stress conditions

  • Experimental Design for Functional Characterization:

    • Creation of knockout, knockdown, and precise base editing variants

    • Development of tissue-specific or inducible editing systems

    • Construction of reporter fusions to study localization and dynamics

Comparative data from different CRISPR approaches can be summarized as follows:

Editing ApproachTargetEditing EfficiencyPhenotype SeverityExperimental Value
Nuclear knockouts of regulatorsTranscription factors60-80%VariableIndirect insights
Base editing of nuclear interactionsAssembly factors40-60%ModerateSpecific interaction disruption
Chloroplast transformationndhC directly5-15%SevereDirect but technically challenging
Prime editingPrecise modifications20-30%TunableHighest precision for mechanism studies

What statistical approaches are most appropriate for analyzing ndhC activity data under varying experimental conditions?

The analysis of ndhC activity data requires robust statistical approaches tailored to the experimental design:

  • For Comparing Multiple Treatments:

    • ANOVA followed by appropriate post-hoc tests (Tukey's HSD for balanced designs)

    • Linear mixed-effects models when incorporating random factors

    • Non-parametric alternatives (Kruskal-Wallis) for non-normally distributed data

  • For Time-Course Experiments:

    • Repeated measures ANOVA with appropriate correction for sphericity

    • Growth curve analysis for continuous monitoring data

    • Time series analysis for identifying periodic patterns

  • For Dose-Response Relationships:

    • Non-linear regression models (Hill equation, logistic function)

    • Estimation of EC50/IC50 values with confidence intervals

    • Comparison of curve parameters across experimental conditions

  • For Multivariate Data Integration:

    • Principal component analysis to identify major sources of variation

    • Partial least squares regression for predictive modeling

    • Canonical correlation analysis for linking multiple data types

The table below provides guidance on statistical approach selection based on experimental design:

Experimental DesignRecommended Primary AnalysisSecondary AnalysisData Transformation
Single-factor comparisonOne-way ANOVATukey's HSDLog transform if heteroscedastic
Multi-factor designFactorial ANOVAInteraction plotsConsider Box-Cox transformation
Repeated measurementsRM-ANOVAMixed-effects modelsAssess need for sphericity correction
Continuous response curvesNon-linear regressionParameter comparisonNone usually required

How should researchers address common technical challenges in measuring ndhC activity in membrane preparations?

Measuring ndhC activity presents several technical challenges that researchers should systematically address:

  • Membrane Integrity Issues:

    • Use gentle isolation procedures maintaining native lipid environment

    • Optimize detergent type and concentration for solubilization

    • Include appropriate osmolytes to stabilize protein complexes

  • Activity Measurement Variability:

    • Standardize protein concentration determination methods

    • Include internal standards in each assay batch

    • Perform technical replicates across multiple biological samples

  • Redox State Management:

    • Control oxygen levels during preparation and assays

    • Include appropriate redox buffers to maintain physiological conditions

    • Monitor and account for spontaneous oxidation of substrates

  • Complex Assembly Verification:

    • Perform native gel electrophoresis to confirm complex integrity

    • Use activity staining to verify functional assembly

    • Combine with western blotting to confirm subunit composition

Troubleshooting strategies can be organized as follows:

What considerations are important when comparing ndhC function across different Solanum species in comparative studies?

Comparative studies of ndhC across Solanum species require careful experimental design to ensure valid comparisons:

  • Genetic Background Considerations:

    • Account for ploidy differences (S. bulbocastanum is diploid while cultivated potato is tetraploid)

    • Consider nuclear-chloroplast interactions specific to each species

    • Evaluate copy number variations that may affect expression levels

  • Growth Condition Standardization:

    • Ensure identical growth parameters across all species

    • Account for different developmental rates between species

    • Standardize stress application protocols for comparative studies

  • Methodological Consistency:

    • Use identical extraction and assay protocols across species

    • Process samples simultaneously when possible

    • Include internal controls to normalize between experiments

  • Evolutionary Context Integration:

    • Consider phylogenetic relationships in data interpretation

    • Account for selective pressures in different habitats

    • Integrate information about species-specific adaptation mechanisms

Structured comparison data can be presented using the following format:

SpeciesOptimal Assay pHTemperature OptimumSalt SensitivityLight Response Magnitude
S. bulbocastanum7.2-7.522-25°CModerateHigh (3-4 fold induction)
S. tuberosum6.8-7.218-22°CHighModerate (2-fold induction)
S. nigrum7.0-7.320-24°CLowModerate (2-3 fold induction)
S. ptycanthum7.1-7.421-25°CLowHigh (3-fold induction)

How can understanding S. bulbocastanum ndhC function contribute to developing stress-resistant crop varieties?

The study of S. bulbocastanum ndhC offers several translational opportunities for crop improvement:

  • Knowledge Transfer Pathways:

    • Identification of key sequence variations contributing to enhanced stress tolerance

    • Understanding regulatory mechanisms that could be targeted in breeding programs

    • Developing molecular markers associated with improved ndhC function

  • Practical Application Strategies:

    • Targeted breeding incorporating S. bulbocastanum germplasm for improved photosynthetic efficiency

    • Precision engineering of cultivated species' ndhC to incorporate beneficial features

    • Development of screening methods to identify lines with optimized cyclic electron flow

  • Integration with Disease Resistance Breeding:

    • Combining ndhC-mediated stress tolerance with known resistance genes like Rpi-blb4

    • Exploring potential synergies between primary metabolism and defense responses

    • Developing multi-trait improvement strategies addressing both biotic and abiotic stress

The implementation timeline for these applications can be projected as:

Application ApproachTechnical FeasibilityTime to ImplementationExpected ImpactKey Challenges
Marker-assisted selectionHigh2-3 yearsModeratePhenotype correlation validation
Introgression breedingModerate5-7 yearsHighLinkage drag
Precision engineeringModerate3-5 yearsHighRegulatory approval
Wild species hybrid developmentModerate7-10 yearsVery highFertility barriers

What research gaps remain in understanding the structure-function relationship of ndhC in photosynthetic efficiency?

Despite advances in understanding ndhC function, several critical knowledge gaps remain:

Priority research areas can be organized as follows:

Research AreaCurrent Knowledge StatusMethodological ApproachesExpected Impact
Structural characterizationLimitedCryo-EM, X-ray crystallographyHigh
Interaction mappingPartialCrosslinking-MS, Y2H screensModerate-high
Real-time dynamicsVery limitedFRET sensors, optogeneticsHigh
Environmental responsivenessFragmentedMulti-omics integrationHigh

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.