Recombinant Solanum bulbocastanum NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Description

Biological Role in Chloroplasts

ndhE is a core component of the NDH complex, which participates in cyclic electron flow (CEF) and chlororespiration. These processes are critical for:

  • Photoprotection: Regulating ATP/NADPH ratios during stress conditions .

  • Redox Balance: Maintaining chloroplast redox homeostasis by coupling NAD(P)H oxidation to proton translocation .

Mechanistic Insight:
ndhE transfers electrons from NAD(P)H to PQ, with FMN and iron-sulfur (Fe-S) clusters acting as redox intermediates. This activity is distinct from mitochondrial NADH dehydrogenases but shares functional parallels with plastid NDH complexes in other plants .

Functional Studies

The recombinant ndhE protein facilitates in vitro assays to:

  • Characterize Enzyme Kinetics: Determine substrate specificity (e.g., NADH vs. NADPH) and PQ binding affinity.

  • Study Subunit Interactions: Probe structural dynamics within the NDH complex (e.g., with NdhB, NdhH) .

B. Genomic Insights from S. bulbocastanum

While ndhE itself is not directly linked to disease resistance, S. bulbocastanum is a key source of resistance genes, such as the RB locus for late blight . Genome-wide analyses reveal:

  • Disease Resistance Genes: Chromosome 11 harbors resistance-associated genes, though ndhE is not mapped to this region .

  • Chloroplast Genome Resources: Databases like ChloroplastDB provide annotations for plastid-encoded genes, aiding comparative studies .

Comparative Analysis with Other NDH Subunits

A comparison of ndhE with NdhB (subunit 2) highlights functional and structural differences:

FeaturendhE (S. bulbocastanum)NdhB (Arabidopsis)
Subunit RoleElectron transferFMN-binding site
Expression SystemRecombinant (E. coli)Native plant systems
TagHis tagNone
ReactivityS. bulbocastanumArabidopsis, Hordeum, Zea

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Solanum bulbocastanum (Wild potato)
Target Names
ndhE
Target Protein Sequence
MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDNRQLKGD IFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNN
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially within a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor for the enzyme. This process couples the redox reaction with proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Solanum bulbocastanum and why is it significant for research?

Solanum bulbocastanum is a wild diploid tuber-bearing plant related to cultivated potato. It has significant research value due to its genetic diversity and potential resistance traits. S. bulbocastanum has distinctly different morphological characteristics from cultivated potato (Solanum tuberosum), including thicker, larger leaves with a more robust appearance . This species serves as an important genetic resource for understanding the evolution of Solanum species and potentially improving crop resilience through genetic engineering approaches.

What genome editing approaches can be applied to study ndhE in Solanum bulbocastanum?

For studying ndhE in Solanum bulbocastanum, researchers can employ transgene-free genome editing using ribonucleoproteins (RNPs) consisting of Cas9 enzyme and sgRNA assembled in vitro . The protocol involves:

  • Protoplast isolation from leaf tissue with optimized enzyme concentrations (specifically, adjusted macerozyme concentration for S. bulbocastanum's thicker leaves)

  • Delivery of pre-assembled Cas9-sgRNA RNP complexes into protoplasts

  • Screening for edited protoplasts

  • Regeneration of whole plants from edited protoplasts via microcalli development

This approach has demonstrated editing efficiencies between 8.5% and 12.4% in S. bulbocastanum protoplast pools . When applying this method specifically to ndhE, researchers should design sgRNAs targeting conserved functional domains of the gene for optimal results.

How can researchers verify successful editing of the ndhE gene?

Verification of successful ndhE gene editing requires a multi-step approach:

  • Initial screening of protoplast pools using PCR amplification of the target region followed by sequencing or enzymatic mismatch detection assays

  • Analysis of individual regenerated plants to identify specific mutation patterns

  • Confirmation of editing in both alleles (for biallelic mutations) or single allele (for monoallelic mutations)

  • Functional validation of the edited protein

Based on protocols optimized for S. bulbocastanum, researchers should expect approximately 14% of regenerated plants to contain edited ndhE genes, with both biallelic and monoallelic mutations possible . Complete verification requires genotypic confirmation followed by phenotypic characterization of photosynthetic parameters.

What experimental design approaches are most effective for studying ndhE function?

An effective experimental design for studying ndhE function requires a systematic approach following Design of Experiments (DOE) principles rather than trial-and-error or one-factor-at-a-time methods . A comprehensive experimental design should include:

  • Factorial design examining multiple factors simultaneously (e.g., light intensity, temperature, and stress conditions)

  • Randomization to minimize systematic errors

  • Replication to ensure statistical validity

  • Blocking to control for unavoidable sources of variability

This approach enables researchers to:

  • Determine whether specific factors affect ndhE function

  • Identify interactions between factors

  • Model ndhE behavior as a function of environmental and genetic factors

  • Optimize experimental conditions for studying the protein

For phenotypic characterization of ndhE-edited plants, researchers should measure multiple parameters including photosynthetic efficiency, stress tolerance, and growth metrics under various environmental conditions.

What are the optimal protocols for expressing and purifying recombinant S. bulbocastanum ndhE protein?

The optimal protocol for expressing and purifying recombinant S. bulbocastanum ndhE protein involves:

  • Expression system selection: Using a prokaryotic system (E. coli) for initial studies, but transitioning to plant-based expression systems for proper post-translational modifications

  • Construct design:

    • Inclusion of a chloroplast transit peptide if studying full-length protein

    • Addition of an affinity tag (His6 or GST) for purification

    • Codon optimization for the expression host

  • Expression conditions optimization:

ParameterRecommended RangeNotes
Temperature16-25°CLower temperatures typically improve folding
Induction concentration0.1-0.5 mM IPTGFor bacterial systems
Expression duration16-24 hoursFor maximum yield with minimal degradation
  • Purification strategy:

    • Initial capture using affinity chromatography

    • Intermediate purification using ion exchange chromatography

    • Final polishing using size exclusion chromatography

  • Activity validation: Spectrophotometric assays monitoring NAD(P)H oxidation or quinone reduction

This methodology leverages principles from successful expression of similar oxidoreductases while addressing the specific challenges of membrane-associated chloroplastic proteins .

How can researchers resolve contradictory data when analyzing ndhE function across different experimental conditions?

When facing contradictory data in ndhE research, researchers should implement a structured approach to identify the source of disagreement:

  • Systematic categorization of contradictions:

    • Methodology-related contradictions (different protocols yielding different results)

    • Interpretation-related contradictions (same data interpreted differently)

    • Context-related contradictions (different experimental conditions)

  • Statistical analysis framework:

    • Meta-analysis of multiple datasets

    • Sensitivity analysis to identify critical parameters

    • Variance analysis to determine significance of contradictions

  • Experimental validation strategy:

    • Design confirmatory experiments specifically targeting the contradictory findings

    • Use multiple alternative techniques to measure the same parameter

    • Include appropriate controls for all potential confounding variables

  • Reporting recommendations:

    • Explicitly acknowledge contradictions in research reports

    • Categorize contradictions based on severity (high, medium, low)

    • Provide potential explanations for observed contradictions

This systematic approach helps researchers determine whether contradictions arise from technical limitations, biological variability, or fundamental misconceptions about ndhE function.

What kinetic parameters should be measured when characterizing recombinant ndhE activity?

Comprehensive kinetic characterization of recombinant ndhE requires measurement of the following parameters:

ParameterDefinitionExperimental ApproachSignificance
Km for NAD(P)HSubstrate concentration at half-maximum reaction rateVaried NAD(P)H concentration at fixed quinone concentrationIndicates substrate affinity
Km for quinoneSubstrate concentration at half-maximum reaction rateVaried quinone concentration at fixed NAD(P)H concentrationIndicates substrate affinity
kcatTurnover number (catalytic rate constant)Direct measurement at saturating substrate concentrationsIndicates catalytic efficiency
kcat/KmSpecificity constantCalculated from measured Km and kcatAllows comparison of efficiency with different substrates
pH optimumpH at which enzyme shows maximum activityActivity assays across pH rangeIndicates physiological context of function
Temperature optimumTemperature at which enzyme shows maximum activityActivity assays across temperature rangeIndicates adaptation to environmental conditions
Inhibition constantsKi for various inhibitorsActivity assays with varying inhibitor concentrationsIdentifies regulatory mechanisms

These measurements should be performed using standardized spectrophotometric assays monitoring the oxidation of NAD(P)H at 340 nm or reduction of quinones using appropriate wavelengths . Sophisticated analysis requires fitting the data to appropriate enzyme kinetic models.

How does the ndhE gene structure in S. bulbocastanum compare to other Solanum species?

The ndhE gene in Solanum species is typically located in the chloroplast genome, with some specific structural characteristics in S. bulbocastanum compared to other species:

  • Gene organization: The ndhE gene in S. bulbocastanum contains a single exon encoding a protein of approximately 100 amino acids, consistent with the compact nature of chloroplast genes.

  • Sequence conservation: Critical functional domains show high conservation across Solanum species, particularly the transmembrane regions and cofactor binding sites.

  • Genomic context: The gene typically resides in a conserved operon with other ndh genes in the chloroplast genome, maintaining synteny across most Solanum species.

  • Regulatory elements: Promoter regions and regulatory elements show more variation between species than the coding regions, possibly reflecting adaptation to different environmental conditions.

Comparative genome analysis requires whole chloroplast genome sequencing followed by detailed annotation and alignment. When examining S. bulbocastanum specifically, researchers should consider its unique evolutionary history and adaptation to specific environments compared to cultivated Solanum species .

What approaches are most effective for analyzing the evolutionary conservation of ndhE across photosynthetic organisms?

Effective evolutionary analysis of ndhE requires a multi-faceted approach:

  • Sequence-based phylogenetic analysis:

    • Multiple sequence alignment of ndhE sequences across diverse photosynthetic organisms

    • Construction of phylogenetic trees using maximum likelihood or Bayesian methods

    • Calculation of selection pressures (dN/dS ratios) to identify conserved functional domains

  • Structure-based evolutionary analysis:

    • Homology modeling of ndhE proteins from diverse species

    • Structural alignment to identify conserved three-dimensional features

    • Analysis of co-evolving residues that maintain structural and functional integrity

  • Comparative genomics approaches:

    • Analysis of synteny across chloroplast genomes

    • Identification of gene loss or duplication events

    • Assessment of horizontal gene transfer potential

  • Correlation with environmental adaptations:

    • Mapping ndhE sequence variations to environmental parameters

    • Testing for correlations between specific amino acid changes and environmental factors

    • Experimental validation of adaptive hypotheses through site-directed mutagenesis

This comprehensive approach provides insights into the evolutionary constraints on ndhE and how this subunit has adapted to different photosynthetic strategies across plant lineages.

How can researchers assess the impact of ndhE mutations on photosynthetic efficiency?

Assessing the impact of ndhE mutations on photosynthetic efficiency requires a comprehensive set of physiological measurements:

These measurements should be performed under both optimal and stress conditions (e.g., high light, drought, temperature extremes) to fully elucidate the role of ndhE in maintaining photosynthetic efficiency, particularly under challenging environments.

What protocols are recommended for studying protein-protein interactions involving ndhE in the chloroplast NDH complex?

Studying protein-protein interactions involving ndhE requires specialized approaches addressing the challenges of membrane-associated chloroplastic proteins:

  • In vivo approaches:

    • Split-GFP or BiFC (Bimolecular Fluorescence Complementation) assays adapted for chloroplast proteins

    • FRET (Förster Resonance Energy Transfer) analysis with appropriate fluorophore pairs

    • In situ proximity ligation assays optimized for chloroplast compartments

  • In vitro approaches:

    • Co-immunoprecipitation using antibodies against ndhE or interacting partners

    • Pull-down assays using tagged recombinant proteins

    • Surface plasmon resonance or microscale thermophoresis for quantitative interaction analysis

  • Structural biology approaches:

    • Cryo-electron microscopy of the entire NDH complex

    • Cross-linking mass spectrometry (XL-MS) to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic interaction regions

  • Computational approaches:

    • Molecular docking simulations

    • Molecular dynamics studies of the NDH complex

    • Coevolution analysis to predict interaction interfaces

These methodologies should be used in combination to build a comprehensive understanding of how ndhE interacts with other subunits in the NDH complex and potentially with other proteins in the chloroplast electron transport chain.

What are the key challenges in genome editing of ndhE in Solanum bulbocastanum and how can they be addressed?

Genome editing of ndhE in Solanum bulbocastanum presents several technical challenges with specific solutions:

  • Challenge: Inefficient protoplast isolation due to S. bulbocastanum's thick, robust leaves
    Solution: Optimize enzyme concentrations, particularly macerozyme, to achieve complete cell wall digestion without compromising protoplast viability

  • Challenge: Low transformation efficiency with RNP complexes
    Solution: Optimize PEG-mediated transformation protocols specifically for S. bulbocastanum protoplasts, including PEG concentration, incubation time, and osmotic conditions

  • Challenge: Difficulty in regenerating plants from edited protoplasts
    Solution: Develop species-specific regeneration protocols with optimized hormone concentrations and culture conditions

  • Challenge: Off-target effects of CRISPR-Cas9 editing
    Solution: Design highly specific sgRNAs using advanced algorithms and verify potential off-target sites through whole genome sequencing

  • Challenge: Chloroplast-localized gene editing
    Solution: For direct chloroplast genome editing, develop specialized chloroplast transformation protocols using biolistics or alternative delivery methods

The reported success rates for gene editing in S. bulbocastanum using optimized protocols range from 8.5% to 12.4% efficiency in protoplast pools, with approximately 14% of regenerated plants showing successful editing .

How can researchers troubleshoot expression problems with recombinant ndhE protein?

When encountering difficulties with recombinant ndhE expression, researchers should implement the following troubleshooting workflow:

ProblemPotential CausesTroubleshooting Steps
Low expression yieldToxicity to host cells1. Use tightly controlled inducible promoters
2. Lower induction temperature
3. Try different host strains optimized for membrane proteins
Protein insolubilityMembrane protein nature1. Use mild detergents for extraction
2. Try fusion partners that enhance solubility
3. Express truncated versions lacking transmembrane domains
Misfolded proteinImproper folding environment1. Co-express with chaperones
2. Include appropriate cofactors in growth media
3. Use specialized strains with enhanced disulfide bond formation
Protein degradationProtease sensitivity1. Add protease inhibitors during purification
2. Use protease-deficient expression strains
3. Optimize purification speed and temperature
Lack of activityMissing cofactors or partners1. Reconstitute with potential cofactors
2. Co-express with other NDH complex subunits
3. Verify protein integrity by mass spectrometry

This systematic approach addresses the common challenges encountered when working with membrane-associated chloroplastic proteins like ndhE . Documentation of all optimization attempts is crucial for method development.

What emerging technologies could advance research on recombinant ndhE and the NDH complex?

Several emerging technologies show promise for advancing ndhE research:

  • Cryo-electron microscopy advancements:

    • High-resolution structural analysis of the entire NDH complex

    • Visualization of conformational changes during electron transport

    • Mapping of interaction interfaces between subunits

  • Single-molecule techniques:

    • FRET-based approaches to study real-time conformational dynamics

    • Optical tweezers to measure force generation during electron transport

    • Single-molecule electrophysiology to study proton translocation

  • Advanced genome editing approaches:

    • Base editing for precise nucleotide substitutions without double-strand breaks

    • Prime editing for targeted insertions and deletions

    • Multiplexed editing for simultaneous modification of multiple ndh genes

  • Synthetic biology approaches:

    • Minimal redesign of the NDH complex with optimized components

    • Engineering novel functions into the complex

    • Creation of hybrid systems with components from diverse species

  • Computational advancements:

    • Quantum mechanical simulations of electron transfer processes

    • Machine learning approaches for predicting protein-protein interactions

    • Systems biology models integrating NDH function with whole-plant physiology

These technologies have the potential to provide unprecedented insights into the structure, function, and regulation of the NDH complex and the specific role of the ndhE subunit.

How might research on S. bulbocastanum ndhE contribute to understanding plant adaptation to environmental stress?

Research on S. bulbocastanum ndhE offers several opportunities for understanding plant stress adaptation:

  • Evolutionary insights:

    • Comparative analysis of ndhE sequences from S. bulbocastanum and related species adapted to different environments

    • Identification of specific amino acid changes that correlate with stress tolerance

    • Understanding how natural selection has shaped NDH complex function in wild species

  • Functional contributions to stress responses:

    • Characterization of NDH-mediated cyclic electron flow under drought, high light, and temperature extremes

    • Assessment of how ndhE variants influence reactive oxygen species (ROS) management

    • Quantification of energy balance maintenance under fluctuating environmental conditions

  • Applied research potential:

    • Identification of beneficial ndhE alleles that could be introduced into cultivated species

    • Development of genetic markers associated with stress tolerance

    • Creation of modified ndhE variants with enhanced stress protection capabilities

  • Mechanistic understanding:

    • Elucidation of how specific structural features of ndhE contribute to NDH complex stability under stress

    • Investigation of potential regulatory modifications of ndhE in response to environmental signals

    • Determination of how ndhE interacts with stress-specific proteins or cofactors

This research has fundamental importance for understanding photosynthetic adaptation to changing environments and potential applications in developing climate-resilient crops.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.