Recombinant Solanum bulbocastanum NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplasts

ndhG is a subunit of the chloroplast NDH complex, which facilitates cyclic electron flow around Photosystem I (PSI) and chlororespiration . Key functions include:

  • Quinone Reduction: Mediates two-electron reduction of plastoquinone to plastoquinol, preventing reactive oxygen species (ROS) generation .

  • Stress Adaptation: Supports drought and pathogen resistance by maintaining redox balance .

  • Genomic Stability: Pseudogenization of ndhG in parasitic plants (e.g., Euphrasia regelii) correlates with reduced photosynthetic capacity, highlighting its essential role in autotrophic species .

Recombinant Expression and Applications

The recombinant protein (Creative Biomart Cat. No. RFL1505MF) is used in:

  • Enzyme Kinetics: Studying FAD-dependent quinone reductase activity .

  • Pathogen Resistance Studies: S. bulbocastanum ndhG-associated NDH complexes enhance tolerance to Phytophthora infestans (late blight) .

  • Molecular Markers: Polymorphisms near ndhG-ndhI regions serve as SNP markers for Solanaceae phylogenetics and breeding .

Genomic and Evolutionary Insights

Comparative chloroplast genome analyses reveal:

  • Inverted Repeat (IR) Boundaries: In S. bulbocastanum, the IRb/SSC junction overlaps ndhF, unlike in Nicotiana tabacum or D. stramonium, where it borders ycf1 .

  • Synteny Conservation: ndhG exhibits high sequence similarity with orthologs in S. tuberosum (potato) and S. lycopersicum (tomato), despite pericentromeric inversions in chromosome 11 .

Research Implications

  • Disease Resistance Breeding: ndhG-linked loci in S. bulbocastanum are introgressed into cultivated potatoes to enhance late blight resistance .

  • Photosynthetic Engineering: Overexpression of ndhG improves electron transport efficiency in transgenic plants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us for prioritized development.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Solanum bulbocastanum (Wild potato)
Target Names
ndhG
Target Protein Sequence
MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSYFVAA AQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGNGITSMVCISLFISLITTISDTSW YGIIWTTRSNQIIEQDFLSNSQQIGIHLSTDFFLPFELISIILLVALIGAIAVARQ
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain, and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the primary electron acceptor. NDH couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Solanum bulbocastanum and why is it significant in potato research?

Solanum bulbocastanum is a wild potato species that serves as an essential source of disease resistance genes for commercial potato breeding programs. It exhibits notable resistance to various pathogens, particularly Columbia root knot nematode (CRKN) and late blight caused by Phytophthora infestans. The genome assembly of S. bulbocastanum (specifically the SB22 selection) has been completed with a size of approximately 655.3 Mb, containing an estimated 43,280 gene models with about 90.3% BUSCO completeness . This species is particularly valuable for potato improvement programs because it contains R-genes that confer durable resistance to all races of P. infestans, making it an indispensable genetic resource for enhancing disease resistance in cultivated potatoes .

What are best practices for designing experiments to study recombinant ndhG protein?

When designing experiments to study recombinant Solanum bulbocastanum ndhG protein, researchers should follow these methodological guidelines:

  • Clearly define variables: Determine which variable will be independent (controlled by the experimenter) and which will be dependent (measured as a result). This distinction should be explicitly stated in the experimental design3.

  • Control for bias: Ensure that experiments are conducted without bias toward expected results, particularly when testing how changing one variable affects another3.

  • Base experimental design on prior research: Use existing literature to guide experimental setup, ensuring that your research extends current knowledge rather than simply repeating established findings .

  • Consider feasibility constraints: Design studies that are realistic in terms of timeframe, budget, and available technology. Avoid research questions that require unavailable resources or unreasonable timeframes .

  • Ensure reproducibility: Design experiments that can be reproduced by other researchers. If results cannot be replicated, they cannot be used to support hypotheses3.

  • Storage considerations: When working with the recombinant protein, store it at -20°C, and for extended storage, conserve at -20°C or -80°C. Avoid repeated freezing and thawing, and consider maintaining working aliquots at 4°C for up to one week .

What expression systems are suitable for producing recombinant ndhG protein?

While the search results don't specifically address expression systems for ndhG, researchers can consider the following methodological approaches based on general recombinant protein expression principles and the information available about the protein:

  • Select appropriate expression host: Given that ndhG is a chloroplastic membrane protein, specialized expression systems designed for membrane proteins may be necessary. Consider using:

    • E. coli strains optimized for membrane protein expression

    • Insect cell expression systems (baculovirus)

    • Plant-based expression systems that may provide proper folding environment

  • Optimize codon usage: Adjust codon usage to match the preferred codons of the expression host to improve expression levels.

  • Consider fusion tags: The product described in the search results mentions that "tag type will be determined during production process" , suggesting that selecting appropriate fusion tags is an important consideration that may vary based on experimental needs.

  • Expression region: Target the expression region to amino acids 1-176, which represents the full-length protein as indicated in the product information .

  • Buffer optimization: Use Tris-based buffer with 50% glycerol, as this has been optimized for this specific protein .

How should researchers approach data collection and analysis when studying ndhG function?

When collecting and analyzing data related to ndhG function, researchers should:

  • Design appropriate controls: Include positive and negative controls in all experiments to validate results and identify potential artifacts.

  • Use multiple analytical approaches: Employ complementary techniques to study protein function, such as:

    • Enzymatic activity assays to measure NAD(P)H oxidation

    • Protein-protein interaction studies to identify binding partners

    • Localization studies to confirm chloroplast membrane association

  • Apply rigorous statistical analysis: Select appropriate statistical methods based on the research question type:

    • For descriptive questions about ndhG characteristics, use descriptive statistics

    • For comparative studies examining differences between wild-type and mutant forms, use comparative statistical approaches

    • For correlational studies examining relationships between ndhG activity and other variables, use correlation analyses

  • Address data contradictions: When faced with conflicting results, consider:

    • Methodological differences between experiments

    • Biological variability in different systems

    • Potential technical artifacts

    • Need for additional replicates or alternative approaches

  • Share data transparently: Make raw data available to other researchers to promote reproducibility and collaborative advancement3.

How might ndhG be involved in disease resistance mechanisms in Solanum bulbocastanum?

The potential involvement of ndhG in disease resistance mechanisms represents an advanced research question. While the search results don't explicitly connect ndhG to disease resistance, researchers can explore this relationship through several methodological approaches:

  • Comparative expression analysis: Study ndhG expression patterns in resistant versus susceptible Solanum species/varieties when challenged with pathogens like Phytophthora infestans or Columbia root knot nematode.

  • Co-expression networks: Analyze whether ndhG expression correlates with known resistance genes. S. bulbocastanum contains numerous R-genes, with 2,310 disease resistance-like genes predicted across its 12 chromosomes .

  • Functional genomics approaches: Consider:

    • RNAi or CRISPR-based knockdown/knockout of ndhG to assess impact on disease susceptibility

    • Overexpression studies to determine if enhanced ndhG levels affect pathogen resistance

  • Redox signaling investigation: Study whether ndhG-mediated alterations in chloroplast redox status might trigger defense responses, as chloroplast-based redox signaling is increasingly recognized as important in plant immunity.

  • Integration with R-gene biology: Examine potential interactions with mapped R-genes, particularly the RB locus on chromosome 8 and Rpi-blb2, which are known to confer resistance to late blight .

What role does ndhG play in chloroplast electron transport and energy metabolism?

NAD(P)H-quinone oxidoreductase subunit 6 (ndhG) is a component of the chloroplast NAD(P)H dehydrogenase complex, which participates in cyclic electron flow around photosystem I. Advanced studies of its role should consider:

How can researchers address the challenges of studying membrane proteins like ndhG?

Membrane proteins present special challenges for structural and functional studies. Researchers can address these through:

  • Solubilization strategies: Test various detergents and lipid nanodiscs to maintain protein stability and function after extraction from membranes.

  • Reconstitution systems: Develop proteoliposome or nanodiscs systems that mimic the native membrane environment for functional studies.

  • Advanced imaging techniques: Apply:

    • Cryo-electron microscopy for structural determination

    • Atomic force microscopy for dynamic studies

    • Confocal microscopy with fluorescent tags for localization

  • Computational approaches: Utilize:

    • Molecular dynamics simulations to study protein-membrane interactions

    • Homology modeling based on related proteins with known structures

    • Quantum mechanical calculations for active site characterization

  • Native complex isolation: Develop techniques to isolate intact NAD(P)H dehydrogenase complexes to study ndhG in its natural protein environment rather than in isolation.

What bioinformatic approaches are recommended for analyzing ndhG sequence conservation across Solanum species?

To analyze ndhG sequence conservation across Solanum species, researchers should employ the following methodological approaches:

  • Multiple sequence alignment: Align ndhG sequences from various Solanum species and other related plants using tools like MUSCLE, CLUSTAL, or T-Coffee.

  • Phylogenetic analysis: Construct phylogenetic trees to visualize evolutionary relationships using:

    • Maximum likelihood methods

    • Bayesian inference

    • Neighbor-joining approaches

  • Selection pressure analysis: Calculate dN/dS ratios to identify regions under positive, neutral, or purifying selection.

  • Protein domain conservation: Compare conservation levels across different functional domains to identify critically conserved regions.

  • Integration with genomic context: Utilize the S. bulbocastanum genome assembly (with 95.7% BUSCO completion score) as a reference point for comparative genomic analysis .

Analysis TypeRecommended ToolsKey Outputs
Sequence AlignmentMUSCLE, CLUSTALConservation scores, variable sites
PhylogeneticsRAxML, MrBayes, MEGAEvolutionary trees, divergence times
Selection AnalysisPAML, HyPhydN/dS ratios, selection hotspots
Domain PredictionInterProScan, PFAMFunctional domain boundaries
Structural PredictionAlphaFold, SWISS-MODEL3D structural models

How can the S. bulbocastanum genome assembly benefit studies of chloroplast proteins like ndhG?

The S. bulbocastanum genome assembly provides a valuable foundation for studying chloroplast proteins like ndhG through:

  • Improved genomic context: The chromosome-level assembly of SB22 (with an N50 of 2,211.9 kb) enables researchers to understand the genomic environment of nuclear-encoded chloroplast proteins, including regulatory elements and neighboring genes .

  • Comparative genomics: The assembly reveals chromosomal inversions and other structural variations compared to cultivated potato (S. tuberosum) that may influence expression patterns of chloroplast-targeted proteins .

  • Integration with transcriptomic data: Though the current assembly used the BRAKER pipeline for gene prediction, future updates could incorporate tissue-specific RNAseq data to improve annotation accuracy, particularly for chloroplast-related genes .

  • Correlation with resistance traits: Researchers can explore potential associations between chloroplast function (including ndhG activity) and mapped disease resistance genes, particularly those for CRKN resistance mapped to chromosome 11 .

  • Evolutionary insights: The high-quality genome enables comparison of chloroplast protein evolution between wild and cultivated potato species, potentially revealing adaptive changes related to environmental stress response.

What experimental approaches can validate in silico predictions about ndhG function?

To validate computational predictions about ndhG function, researchers should consider these methodological approaches:

  • Site-directed mutagenesis: Modify predicted functional residues and assess impact on:

    • Protein folding and stability

    • Complex assembly

    • Enzymatic activity

    • Electron transport rates

  • Protein-protein interaction studies:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation

    • Bimolecular fluorescence complementation

    • Proximity labeling techniques

  • Genetic complementation: Express S. bulbocastanum ndhG in model systems with ndhG mutations or deletions to test functional conservation.

  • Expression pattern analysis: Validate predicted expression patterns using:

    • qRT-PCR

    • RNA-seq

    • Promoter-reporter fusions

  • Metabolic profiling: Measure changes in relevant metabolites in systems with altered ndhG expression to confirm predicted metabolic roles.

How might understanding ndhG function contribute to potato breeding programs?

Understanding ndhG function could contribute to potato breeding programs through several research-driven pathways:

  • Enhanced photosynthetic efficiency: If ndhG plays a critical role in optimizing photosynthesis under stress conditions, characterizing natural variants could identify alleles that improve energy production in commercial varieties.

  • Stress tolerance improvement: Chloroplast NAD(P)H dehydrogenase activity has been implicated in responses to various stresses. Understanding how S. bulbocastanum ndhG contributes to the species' robustness could inform breeding for climate resilience.

  • Disease resistance connections: Though speculative, potential connections between chloroplast function and the exceptional disease resistance of S. bulbocastanum merit investigation, as chloroplasts play roles in defense signaling. The species contains numerous R-genes, with 2,310 disease resistance-like genes predicted across its 12 chromosomes .

  • Marker-assisted selection: If specific ndhG variants are associated with desirable traits, molecular markers could be developed to track these variants in breeding populations.

  • Integration with other breeding objectives: Researchers must consider how ndhG optimization might interact with other breeding goals, potentially using the high-quality S. bulbocastanum genome assembly to identify linked traits .

What methodological approaches are recommended for integrating ndhG research into broader studies of wild potato germplasm?

To effectively integrate ndhG research into broader studies of wild potato germplasm, researchers should:

  • Employ comparative genomics: Utilize the S. bulbocastanum genome assembly (NCBI project id: PRJNA1003451) as a reference point to study ndhG variation across wild potato species and accessions .

  • Characterize allelic diversity: Survey ndhG sequence variation in germplasm collections to identify natural variants that might confer adaptive advantages.

  • Conduct association studies: Correlate ndhG variants with phenotypic traits of interest across diverse germplasm.

  • Develop functional markers: Design molecular markers for ndhG variants with demonstrated functional significance for use in germplasm screening.

  • Integrate with resistance breeding: Consider potential interactions between chloroplast function and the well-characterized disease resistance traits of S. bulbocastanum, such as the RB gene on chromosome 8 that confers resistance to late blight .

What future research directions might emerge from studies of ndhG in the context of potato improvement?

Future research directions emerging from studies of ndhG in potato improvement might include:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.