Recombinant Solanum bulbocastanum Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Solanum bulbocastanum CP47 (psbB)

Recombinant Solanum bulbocastanum Photosystem II CP47 chlorophyll apoprotein (psbB) is a genetically engineered variant of the intrinsic chlorophyll-binding protein critical for light absorption and energy transfer in Photosystem II (PSII). This recombinant protein is produced in Escherichia coli (E. coli) expression systems, enabling biochemical and structural studies of PSII assembly and function .

Expression System:

  • Host: E. coli (BL21 or similar strains) .

  • Vector: Plasmid with inducible promoter (e.g., T7) and antibiotic resistance .

Purification Protocol:

  1. Affinity Chromatography: His-tag-based purification using Ni-NTA columns .

  2. Buffer Composition: Tris/PBS-based buffer with 6% trehalose (pH 8.0) for stabilization .

  3. Reconstitution: Lyophilized protein reconstituted in sterile water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage .

Quality Control:

  • Purity: Validated via SDS-PAGE and mass spectrometry .

  • Activity: Functional assays (e.g., chlorophyll fluorescence) confirm energy transfer capability .

PSII Assembly Studies

  • Role in Intermediate Complexes: Recombinant CP47 homologs in Synechocystis sp. PCC 6803 bind to assembly factors (e.g., Psb28, Psb34) to stabilize the RC47 complex (D1/D2/CP47) during PSII repair .

  • Mutant Analyses: Deletion of psbB in cyanobacteria disrupts PSII assembly, highlighting its indispensability .

Evolutionary Conservation in Solanaceae

  • Plastid Genome Analysis: psbB is highly conserved across Solanaceae species (e.g., Solanum lycopersicum, Solanum tuberosum) with minimal sequence divergence (avg. pairwise distance <0.10) .

  • SSR Motifs: Mono- and trinucleotide repeats in psbB suggest regulatory roles in gene expression .

Comparative Analysis With Homologs

SpeciesUniProt IDKey Differences
Spinacia oleraceaP0416098% sequence identity; identical chlorophyll-binding domains
Cyanophora paradoxaP4810387% identity; divergent N-terminal region impacting antenna efficiency
Lactuca sativaQ332V195% identity; conserved transmembrane helices but altered luminal loops

Challenges and Limitations

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; aliquoting is mandatory .

  • Lack of Native Modifications: Absence of eukaryotic glycosylation or lipidation may limit functional studies .

Future Directions

  • Cryo-EM Studies: High-resolution structural analysis of recombinant CP47 in PSII assembly intermediates .

  • Chlorophyll Biosynthesis: Investigating CP47’s role in regulating protochlorophyllide synthesis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Solanum bulbocastanum (Wild potato)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAA
Uniprot No.

Target Background

Function
CP47 is a component of the core complex of photosystem II (PSII). It binds chlorophyll and contributes to the catalysis of the primary light-induced photochemical processes of PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, producing O2 and a proton gradient subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem II CP47 chlorophyll apoprotein (psbB) and what is its function in plants?

Photosystem II CP47 chlorophyll apoprotein (psbB) is a critical component of the photosynthetic machinery in plants. It functions as a core antenna protein within Photosystem II, binding chlorophyll molecules and facilitating light energy transfer to the reaction center. The protein plays an essential role in the initial steps of photosynthesis, specifically in the water-splitting process that generates oxygen, protons, and electrons . As one of the longest proteins in the photosystem II group, psbB forms a crucial structural component that maintains the integrity and functionality of the photosynthetic apparatus in chloroplasts . It is encoded by the plastid genome and conserved across numerous plant species, highlighting its evolutionary importance.

How does Solanum bulbocastanum psbB compare to that of other Solanaceae species?

Comparative genomic analyses of Solanaceae species reveal that psbB is highly conserved across this plant family. While specific information about Solanum bulbocastanum psbB is limited in the provided search results, we can infer from related research that the gene structure likely remains consistent with other Solanaceae members . Notably, Solanum bulbocastanum shows some genetic distinctions, as evidenced by its longer psbC gene (1422 bp) compared to other studied Solanaceae species . This suggests that while the core photosynthetic genes maintain functional conservation, species-specific variations do exist. Based on data from related species such as Solanum tuberosum, we can expect the S. bulbocastanum psbB gene to be approximately 1,500-1,600 bp in length, making it one of the longest genes in the photosystem II group .

What expression systems are typically used for producing recombinant Photosystem II proteins?

For the expression of recombinant Photosystem II proteins like CP47 chlorophyll apoprotein (psbB), Escherichia coli is the predominant expression system. Based on protocols used for similar proteins, recombinant Solanum tuberosum and Lactuca sativa psbB proteins are successfully expressed in E. coli with N-terminal His tags . This bacterial expression system offers several advantages for research purposes, including rapid growth, high protein yields, and well-established transformation protocols. The full-length protein (typically 508 amino acids for related species) can be effectively produced using this approach . For researchers working with Solanum bulbocastanum psbB, adapting these established E. coli-based expression protocols would be a logical starting point, with appropriate modifications to accommodate any species-specific sequence variations.

What are the optimal storage and handling conditions for recombinant psbB proteins?

Based on established protocols for similar recombinant proteins, optimal storage and handling of recombinant Solanum bulbocastanum psbB protein would follow these guidelines:

  • Long-term storage: Store lyophilized protein at -20°C to -80°C

  • Working aliquots: Store at 4°C for up to one week to maintain stability

  • Reconstitution procedure:

    • Briefly centrifuge the vial before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity and stability

These handling protocols are critical for maintaining the structural integrity and functional properties of the recombinant protein during experimental procedures.

What purification methods yield the highest purity for recombinant psbB proteins?

For recombinant Photosystem II CP47 chlorophyll apoprotein (psbB) with a His tag, affinity chromatography using nickel or cobalt resins is the method of choice for initial purification. This approach takes advantage of the strong interaction between the His tag and metal ions to selectively capture the target protein from the bacterial lysate. To achieve research-grade purity (>90% as determined by SDS-PAGE), a multi-step purification strategy is recommended :

  • Initial capture: Immobilized metal affinity chromatography (IMAC)

  • Intermediate purification: Ion exchange chromatography to separate based on charge differences

  • Polishing step: Size exclusion chromatography to remove aggregates and achieve final purity

For researchers working with Solanum bulbocastanum psbB, it's advisable to monitor purification efficiency at each step using SDS-PAGE and Western blotting with anti-His antibodies to confirm protein identity and assess purity.

How can researchers verify the structural integrity of purified recombinant psbB protein?

Multiple complementary techniques should be employed to verify the structural integrity of purified recombinant Solanum bulbocastanum psbB protein:

TechniquePurposeExpected Result
Circular Dichroism (CD)Secondary structure analysisAlpha-helical content consistent with transmembrane protein
Size Exclusion Chromatography (SEC)Oligomeric state and aggregation assessmentPredominantly monomeric with defined elution profile
SDS-PAGEMolecular weight verificationSingle band at approximately 56 kDa (including His tag)
Mass SpectrometryAccurate mass determination and sequence verificationMass matching theoretical prediction based on amino acid sequence
Limited ProteolysisDomain structure assessmentResistant fragments corresponding to stable structural domains

Researchers should also consider functional assays that measure chlorophyll binding capacity, as this is a key functional characteristic of the native protein. Comparing these results with data from native psbB isolated from chloroplasts can provide valuable insights into the structural fidelity of the recombinant protein.

What experimental approaches can differentiate between functional and non-functional recombinant psbB protein?

Distinguishing between functional and non-functional recombinant Solanum bulbocastanum Photosystem II CP47 chlorophyll apoprotein requires specialized biophysical and biochemical assays:

  • Chlorophyll binding assay: Functional psbB should bind chlorophyll molecules with specific stoichiometry. Researchers can measure this using absorption spectroscopy and fluorescence techniques to determine binding constants and occupancy.

  • Protein-protein interaction studies: Functional psbB must correctly interact with other Photosystem II components. Techniques such as co-immunoprecipitation, surface plasmon resonance, or microscale thermophoresis can quantify these interactions.

  • Reconstitution experiments: Attempting to incorporate the recombinant protein into artificial membrane systems or isolated thylakoid membranes depleted of native psbB can demonstrate functional integration.

  • Electron transfer measurements: Using artificial electron donors and acceptors, researchers can assess whether the recombinant protein supports electron transport pathways characteristic of Photosystem II.

  • Structural analysis: Comparing the three-dimensional structure of recombinant and native proteins using techniques like X-ray crystallography or cryo-electron microscopy can reveal structural deviations that might affect function.

These approaches collectively provide a comprehensive assessment of whether the recombinant protein retains the functional properties of the native counterpart.

How do sequence variations in psbB across Solanum species correlate with photosynthetic efficiency?

Comparative sequence analysis of psbB across Solanum species reveals both conserved and variable regions that may influence photosynthetic performance. While specific data on Solanum bulbocastanum is limited in the provided search results, general patterns can be inferred from related species:

  • Core transmembrane domains containing chlorophyll-binding sites show high conservation, reflecting their critical functional role in light harvesting and energy transfer .

  • Loop regions and surface-exposed segments display greater variability, potentially contributing to species-specific adaptations to different light environments and stress conditions.

  • Key amino acid residues involved in interactions with other Photosystem II components remain largely invariant, ensuring proper assembly of the photosynthetic apparatus.

Researchers investigating Solanum bulbocastanum specifically should conduct sequence alignment analyses with other Solanum species, particularly focusing on amino acid positions known to influence chlorophyll binding, protein stability, and interaction with other photosystem components. Correlating these sequence variations with photosynthetic parameters measured in different species could provide valuable insights into structure-function relationships and evolutionary adaptations.

What are the challenges in expressing full-length transmembrane proteins like psbB in bacterial systems?

Expressing full-length transmembrane proteins such as Photosystem II CP47 chlorophyll apoprotein (psbB) in bacterial systems presents several significant challenges:

  • Membrane protein toxicity: Overexpression of membrane proteins can disrupt host cell membrane integrity, leading to growth inhibition and reduced yields. Researchers often need to use tightly controlled inducible expression systems and optimize induction conditions (temperature, inducer concentration, induction time) to balance expression and toxicity.

  • Protein folding and stability: Bacterial cytoplasmic membranes differ significantly from thylakoid membranes in composition and physical properties. This mismatch can lead to improper folding, aggregation, or degradation of recombinant psbB. Inclusion of molecular chaperones or fusion partners may improve folding efficiency.

  • Post-translational modifications: Plants may incorporate specific modifications absent in bacterial systems. While E. coli can successfully express the basic polypeptide , it lacks the machinery for certain plant-specific modifications that might be important for full functionality.

  • Cofactor incorporation: Native psbB binds multiple chlorophyll molecules essential for its function. Bacterial systems do not produce chlorophyll, necessitating either in vitro reconstitution with purified pigments or co-expression of chlorophyll biosynthesis genes.

  • Extraction and purification complexity: Membrane proteins require detergents or other solubilizing agents for extraction from membranes. Finding conditions that efficiently extract the protein while maintaining native structure remains challenging.

These challenges explain why researchers often work with related species like Solanum tuberosum as models and adapt successful protocols from these systems when approaching new targets like Solanum bulbocastanum psbB .

How does the amino acid sequence of Solanum bulbocastanum psbB compare with that of other agricultural crops?

Comparative analysis of psbB sequences across agricultural crops reveals patterns of conservation and divergence that reflect both evolutionary relationships and functional constraints. Based on information from related species:

SpeciesSequence Identity to S. tuberosum psbBNotable Differences
Solanum tuberosum (Potato)100% (reference)Reference sequence
Lactuca sativa (Lettuce)~95%Variations in non-critical loop regions
Solanum bulbocastanumEstimated 98-99%Limited specific data available
Other Solanaceae95-99%Minor variations in surface-exposed regions
Non-Solanaceae crops85-95%Greater divergence while maintaining core functional domains

The high sequence conservation, particularly in transmembrane and chlorophyll-binding domains, underscores the functional importance of psbB across diverse plant species. Researchers interested in crop improvement may focus on the small number of variable residues that could contribute to differential photosynthetic efficiency or stress tolerance between species.

What experimental designs are most effective for studying the interaction between recombinant psbB and other Photosystem II components?

To effectively study interactions between recombinant Solanum bulbocastanum psbB and other Photosystem II components, researchers can employ several complementary approaches:

  • Co-expression systems: Simultaneously express multiple Photosystem II proteins in the same host to promote proper complex formation. This can be achieved using polycistronic vectors or co-transformation strategies.

  • Pull-down assays: Leverage the His tag on recombinant psbB to capture interaction partners from plant extracts, followed by mass spectrometry identification of bound proteins.

  • Surface Plasmon Resonance (SPR): Immobilize purified recombinant psbB on a sensor chip and measure real-time binding kinetics with other purified Photosystem II components.

  • Reconstitution in liposomes: Incorporate recombinant psbB into artificial membrane systems along with other purified photosystem components to assess complex assembly and function.

  • Förster Resonance Energy Transfer (FRET): Introduce fluorescent labels at specific sites in psbB and potential interaction partners to monitor proximity and structural arrangements in reconstituted systems.

  • Cross-linking coupled with mass spectrometry (XL-MS): Use chemical cross-linkers to capture transient interactions, followed by proteolytic digestion and mass spectrometry to identify cross-linked peptides, providing spatial constraints for molecular modeling.

These methods collectively provide a multi-faceted view of the structural and functional relationships between psbB and its interaction partners in the photosynthetic apparatus.

What are the most common pitfalls in the expression and purification of recombinant psbB, and how can they be addressed?

Researchers working with recombinant Solanum bulbocastanum Photosystem II CP47 chlorophyll apoprotein (psbB) frequently encounter several challenges. Here are the most common issues and their solutions:

  • Low expression levels:

    • Problem: Membrane protein toxicity inhibiting host cell growth

    • Solution: Reduce induction temperature (16-20°C), decrease inducer concentration, use specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Protein aggregation/inclusion body formation:

    • Problem: Improper folding in the bacterial environment

    • Solution: Co-express molecular chaperones, use fusion partners that enhance solubility, optimize buffer conditions during cell lysis

  • Poor protein stability after purification:

    • Problem: Rapid degradation or aggregation during storage

    • Solution: Include glycerol (5-50%) in storage buffer, store at appropriate temperature (-20°C/-80°C), aliquot to avoid freeze-thaw cycles

  • Contaminating proteins after affinity purification:

    • Problem: Non-specific binding to affinity resin

    • Solution: Increase imidazole concentration in wash buffers, add additional purification steps (ion exchange, size exclusion chromatography)

  • Loss of structural integrity:

    • Problem: Detergent-induced structural changes

    • Solution: Screen multiple detergents at various concentrations, consider using amphipols or nanodiscs for stabilization after purification

Implementing these strategies can significantly improve the yield and quality of recombinant psbB protein for subsequent functional and structural studies.

How can researchers distinguish between research artifacts and genuine findings when working with recombinant photosynthetic proteins?

Distinguishing between artifacts and genuine findings when studying recombinant photosynthetic proteins like Solanum bulbocastanum psbB requires rigorous experimental design and appropriate controls:

  • Multiple expression and purification methods:

    • Compare properties of protein prepared by different methods to identify procedure-dependent artifacts

    • Validate key findings using protein prepared by at least two independent approaches

  • Comparison with native protein:

    • Whenever possible, isolate native psbB from plant material for side-by-side comparison

    • Any functional or structural differences may indicate artifacts in the recombinant system

  • Concentration-dependent experiments:

    • Test whether observed effects scale proportionally with protein concentration

    • Non-linear relationships may indicate aggregation or non-specific interactions

  • Buffer condition controls:

    • Perform parallel experiments in different buffer systems to ensure findings are not buffer-dependent

    • Pay particular attention to detergent effects on membrane protein behavior

  • Replication and statistical analysis:

    • Conduct multiple independent experiments with fresh protein preparations

    • Apply appropriate statistical tests to determine significance of results

  • Complementary techniques:

    • Confirm key findings using multiple biophysical or biochemical methods

    • Agreement across different experimental approaches strengthens confidence in results

What emerging technologies might enhance our understanding of psbB structure-function relationships?

Recent technological advances offer exciting opportunities to deepen our understanding of Solanum bulbocastanum psbB structure-function relationships:

  • Cryo-electron microscopy (Cryo-EM): The "resolution revolution" in cryo-EM now enables visualization of membrane protein structures at near-atomic resolution without crystallization. This technique could reveal the precise arrangement of psbB within the Photosystem II complex and its interactions with chlorophyll molecules and neighboring proteins.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can map protein dynamics and solvent accessibility, providing insights into conformational changes in psbB under different physiological conditions or in response to environmental stressors.

  • Single-molecule fluorescence techniques: Methods such as single-molecule FRET can track dynamic processes in individual protein complexes, potentially revealing heterogeneity and transient states not detectable in ensemble measurements.

  • Artificial intelligence for protein structure prediction: Tools like AlphaFold2 can now predict protein structures with remarkable accuracy, offering a computational approach to modeling psbB structure, particularly in species like Solanum bulbocastanum where experimental structures may not be available.

  • CRISPR-Cas9 gene editing: Precise modification of specific residues in the native psbB gene can create a series of variants to test structure-function hypotheses in planta, complementing in vitro studies with recombinant proteins.

  • Integrative structural biology: Combining multiple data sources (X-ray crystallography, cryo-EM, mass spectrometry, computational modeling) can provide more comprehensive structural models than any single technique alone.

These emerging approaches, when applied to Solanum bulbocastanum psbB, promise to reveal new insights into photosynthetic machinery that could ultimately inform crop improvement strategies.

How might research on wild potato species psbB contribute to improving photosynthetic efficiency in cultivated crops?

Research on Photosystem II CP47 chlorophyll apoprotein (psbB) from wild potato species like Solanum bulbocastanum has significant potential for improving agricultural productivity through several pathways:

  • Genetic diversity exploration: Wild Solanum species represent an untapped reservoir of genetic variation in photosynthetic genes. Comparative analysis of psbB sequences across these species may reveal naturally occurring variants with enhanced properties . Solanum bulbocastanum, in particular, has evolved in different environmental conditions than cultivated potatoes, potentially developing adaptations for stress tolerance or resource utilization.

  • Hybrid protein engineering: Identifying beneficial sequence variations in wild species psbB could inform targeted genetic modifications in cultivated crops. Combining advantageous features from multiple species through precise gene editing or traditional breeding approaches may create improved photosynthetic machinery.

  • Stress adaptation mechanisms: Wild potato species often demonstrate superior tolerance to environmental stressors. Characterizing how their psbB proteins maintain function under adverse conditions (high light, temperature extremes, drought) could reveal protective mechanisms transferable to cultivated varieties.

  • Evolutionary insights: Comparing psbB across the Solanum genus provides a window into the evolutionary history of photosynthetic machinery . Understanding the selective pressures that have shaped these proteins can guide efforts to engineer improved variants for current and future agricultural challenges.

  • Biodiversity conservation rationale: Documenting the unique photosynthetic adaptations in wild species strengthens the case for their conservation, ensuring these genetic resources remain available for future crop improvement efforts.

By bridging fundamental research on wild species with applied agricultural goals, studies of Solanum bulbocastanum psbB contribute to both our basic understanding of photosynthesis and the development of more resource-efficient crop varieties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.