Recombinant Solanum bulbocastanum Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is expressed in E. coli and purified under stringent conditions:

  • Expression System: E. coli BL21(DE3) or similar strains .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -20°C/-80°C .

  • Reconstitution: Solubilized in deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term stability .

Functional Role in Photosynthesis

The D1 protein encoded by psbA is indispensable for PSII function:

  • Electron Transport: Facilitates electron transfer from water to plastoquinone (Q<sub>B</sub>) .

  • Herbicide Binding Site: Target for triazine and urea-based herbicides, which block Q<sub>B</sub> binding .

  • Photodamage Repair: Light-induced psbA translation replaces damaged D1 proteins, maintaining PSII activity .

Applications in Research

This recombinant protein is widely used in:

  • Mechanistic Studies: Investigating herbicide resistance, electron transport kinetics, and PSII repair mechanisms .

  • Structural Biology: Crystallography and mutagenesis to map functional domains (e.g., Q<sub>B</sub>-binding pocket) .

  • Biotechnological Tools: Antigen for ELISA kits and antibody production .

Comparative Analysis with Homologs

Functional and structural variations exist among psbA proteins across species:

SpeciesKey DifferencesImplications
Solanum tuberosum (Potato)98% sequence identity; partial recombinant variants used for antibody production .Conserved function in crop plants.
Prorocentrum micans (Algae)Distinct transmembrane helix arrangement near Q<sub>B</sub> site .Evolutionary adaptations to marine environments.
Anacystis nidulans (Cyanobacteria)Three psbA gene variants with differential herbicide sensitivity .Model for studying photodamage repair mechanisms.

Research Findings

Recent studies highlight:

  • Q<sub>B</sub>-Binding Efficiency: Substitutions at Pheo<sub>D1</sub> (Pheo<sub>D1</sub>–His<sub>198</sub> hydrogen bond) enhance plastoquinone exchange rates in psbA3 variants .

  • Gene Expression Regulation: psbA mRNA translation is triggered by D1 photodamage, independent of photosynthetic electron flow .

  • Thermostability: S. bulbocastanum psbA shows higher thermal resilience compared to cyanobacterial homologs .

Future Directions

Ongoing research aims to:

  • Engineer herbicide-resistant crops using psbA mutagenesis .

  • Optimize recombinant production for structural studies of PSII .

  • Explore S. bulbocastanum’s resilience mechanisms under abiotic stress .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format preferences, please indicate them during order placement. We will accommodate your requests to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice packaging is required, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is finalized during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Solanum bulbocastanum (Wild potato)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient that is subsequently used for ATP formation. PSII comprises a core antenna complex, responsible for capturing photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the Solanum bulbocastanum psbA protein?

The Solanum bulbocastanum psbA protein (also known as Photosystem II protein D1 or PSII D1 protein) is a full-length protein consisting of 344 amino acids. The protein has a specific amino acid sequence that includes MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA . This sequence forms a functional protein that is integral to photosystem II, specifically acting as the QB protein component involved in electron transport during photosynthesis.

How does the psbA protein function in photosynthetic electron transport?

The psbA protein serves as the QB protein of photosystem II and is essential for oxygenic photosynthetic electron transport . It functions as a key component in the electron transfer chain, accepting electrons from the primary electron acceptor QA and transferring them to the plastoquinone pool. The protein contains binding sites for plastoquinone molecules and facilitates their reduction during photosynthesis. This electron transport function is critical for the light-dependent reactions of photosynthesis, contributing to the establishment of proton gradients that drive ATP synthesis. The protein's structure is optimized for efficient electron transfer while maintaining stability under the oxidative conditions of photosystem II.

What evolutionary significance does the psbA gene family have in photosynthetic organisms?

Studies in cyanobacteria, such as Anacystis nidulans R2, reveal that photosynthetic organisms may contain multiple psbA genes (e.g., three genes in A. nidulans) that encode the QB protein . This gene redundancy likely evolved as an adaptation to ensure continued photosynthetic function under various environmental conditions. Interestingly, in A. nidulans, two of the genes (psbAII and psbAIII) encode identical proteins, while the psbAI gene product differs by 25 out of 360 amino acid residues . Despite these differences, each gene is independently capable of producing sufficient functional QB protein to support normal photoautotrophic growth . This evolutionary strategy provides flexibility in gene expression and protein production, potentially allowing photosynthetic organisms to adapt to changing light conditions, herbicide exposure, or other environmental stressors that might impact photosystem II function.

What are the optimal conditions for expressing recombinant S. bulbocastanum psbA in E. coli?

Recombinant expression of S. bulbocastanum psbA in E. coli requires careful optimization of several parameters. The protein is typically expressed with an N-terminal His-tag to facilitate purification . For optimal expression, researchers should consider using specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)), as the psbA protein is naturally integrated into thylakoid membranes. The expression construct should incorporate strong promoters (such as T7) with inducible control.

Optimal induction conditions typically include:

  • Growth temperature reduction to 16-18°C post-induction

  • IPTG concentration between 0.1-0.5 mM

  • Induction at mid-log phase (OD600 of 0.6-0.8)

  • Extended expression time (16-20 hours)

Additionally, supplementing the growth medium with specific cofactors or membrane components may improve proper folding of the recombinant protein. The expressed protein should be verified for integrity using SDS-PAGE and Western blotting with antibodies specific to either the His-tag or psbA protein epitopes.

What purification strategies yield the highest purity and functional integrity of recombinant psbA protein?

Purification of recombinant His-tagged S. bulbocastanum psbA protein requires a multi-step approach to maintain functional integrity while achieving high purity (>90%) . The recommended purification workflow includes:

  • Initial extraction: Use mild detergents (DDM, LDAO, or Triton X-100) for membrane solubilization

  • Immobilized metal affinity chromatography (IMAC): Apply solubilized protein to Ni-NTA resin

  • Washing: Multiple washing steps with increasing imidazole concentrations (10-40 mM)

  • Elution: Gradient or step elution with higher imidazole concentration (250-500 mM)

  • Size exclusion chromatography: Secondary purification to remove aggregates and contaminants

  • Buffer exchange: Into a storage buffer containing stabilizing agents

The final purified protein should be maintained in Tris/PBS-based buffer at pH 8.0 with 6% trehalose to enhance stability . For long-term storage, it is recommended to add glycerol (5-50% final concentration, with 50% being optimal) and store aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles . This approach preserves both structural integrity and functional activity of the purified psbA protein.

How can researchers validate the functional integrity of purified recombinant psbA protein?

Validating the functional integrity of purified recombinant psbA protein requires multiple complementary approaches focused on both structural characteristics and electron transport functionality:

  • Structural validation:

    • SDS-PAGE analysis to confirm molecular weight (approximately 38 kDa)

    • Circular dichroism spectroscopy to verify secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to determine protein stability

  • Functional validation:

    • Binding assays with quinone analogs

    • Herbicide binding assays (as psbA is a target for several herbicides)

    • Reconstitution into liposomes or nanodiscs for electron transport assays

    • Electron paramagnetic resonance (EPR) spectroscopy to measure electron transfer capabilities

  • Spectroscopic analysis:

    • Absorbance spectroscopy (400-700 nm range)

    • Fluorescence emission spectra

    • Time-resolved fluorescence to measure energy transfer kinetics

The protein should demonstrate specific binding to plastoquinone and exhibit characteristic spectroscopic properties consistent with properly folded photosystem II D1 protein. Additionally, the recombinant protein should show sensitivity to known photosystem II inhibitors as a functional validation parameter.

How can recombinant psbA be utilized in studying herbicide resistance mechanisms?

Recombinant psbA protein serves as an excellent model for studying herbicide resistance mechanisms since the QB protein is a direct target for several herbicides that inhibit photosynthesis . Researchers can employ the following methodological approaches:

  • Site-directed mutagenesis studies:

    • Generate specific amino acid substitutions in the psbA sequence based on known or predicted herbicide binding sites

    • Express and purify these mutant variants alongside wild-type protein

    • Compare herbicide binding affinities using isothermal titration calorimetry or surface plasmon resonance

  • Structural analysis:

    • Perform co-crystallization of the recombinant protein with various herbicides

    • Use cryo-electron microscopy to determine the precise binding modes of herbicides

    • Identify structural changes associated with herbicide resistance mutations

  • Functional comparisons:

    • Develop electron transport assays comparing wild-type and mutant proteins

    • Measure inhibition constants (Ki) for different herbicides

    • Correlate structural changes with functional impacts on photosynthetic efficiency

These approaches enable researchers to understand the molecular basis of herbicide resistance and potentially design more effective or selective herbicides that address resistance issues in crop protection strategies. The recombinant protein system allows for rapid screening of mutations and their effects without the complexities of whole-plant systems.

What relationships exist between psbA and resistance gene networks in Solanum bulbocastanum?

While psbA functions in photosynthesis, Solanum bulbocastanum is also known for its disease resistance properties, particularly against late blight caused by Phytophthora infestans . The relationship between photosynthetic efficiency (involving psbA) and disease resistance pathways presents an intriguing research area:

  • Transcriptional coordination:

    • During pathogen infection, plants must balance energy allocation between defense and photosynthesis

    • Researchers can investigate if psbA expression changes during pathogen challenge

    • RNA-seq analyses comparing healthy and infected tissues can reveal coordinated expression patterns

  • Metabolic interactions:

    • Photosynthetic efficiency (mediated by psbA) affects the energy available for defense responses

    • The RB resistance gene from S. bulbocastanum belongs to the CC-NBS-LRR class of resistance proteins

    • Studies can examine if compromised photosynthesis (through psbA mutations) affects the efficiency of RB-mediated resistance

  • Signaling pathway overlaps:

    • Both photosynthetic regulation and disease resistance involve reactive oxygen species signaling

    • Research can explore if there are shared regulatory elements between psbA and resistance genes

    • Protein-protein interaction studies might reveal unexpected connections between photosynthetic and defense components

Understanding these relationships could provide insights into developing crop varieties with both enhanced photosynthetic efficiency and durable disease resistance, potentially addressing multiple agricultural challenges simultaneously.

How do post-translational modifications affect psbA protein function and turnover?

The psbA protein (D1) undergoes several post-translational modifications that are critical for its function and regulation. Research methodologies to study these modifications include:

  • Phosphorylation analysis:

    • Use phosphoproteomics to identify specific phosphorylation sites

    • Express recombinant psbA with phosphomimetic mutations (S/T to D/E)

    • Compare electron transport efficiency and protein stability between wild-type and modified variants

  • Oxidative damage assessment:

    • The D1 protein is particularly susceptible to oxidative damage during photosynthesis

    • Expose recombinant protein to controlled oxidative conditions

    • Use mass spectrometry to identify oxidation-sensitive residues

    • Correlate oxidative modifications with protein turnover rates

  • Degradation pathway studies:

    • Develop in vitro degradation assays using recombinant proteases

    • Identify protease recognition sites and cleavage patterns

    • Compare degradation kinetics between different post-translationally modified forms

These studies can provide critical insights into the regulation of photosystem II repair cycles, which are essential for maintaining photosynthetic efficiency under various environmental conditions. The recombinant psbA protein serves as an excellent substrate for developing these assays and understanding the molecular mechanisms governing D1 protein turnover.

What are the optimal storage conditions for maintaining long-term stability of recombinant psbA protein?

Long-term stability of recombinant psbA protein requires careful attention to storage conditions. Based on established protocols, researchers should implement the following methodology:

  • Lyophilization approach:

    • Purified protein should be lyophilized in a protective buffer containing cryoprotectants

    • The recommended buffer composition is Tris/PBS-based with 6% trehalose at pH 8.0

    • Avoid buffers containing reducing agents that may affect disulfide bonds

  • Storage temperature considerations:

    • Store lyophilized powder at -20°C/-80°C for long-term stability

    • For working aliquots, storage at 4°C is acceptable for up to one week

    • Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided

  • Reconstitution methodology:

    • Prior to opening, vials should be briefly centrifuged to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (optimally 50%)

    • Aliquot into smaller volumes before refreezing to minimize freeze-thaw cycles

When implementing this storage protocol, researchers can expect to maintain >90% protein activity for at least 6-12 months. Regular quality control testing using SDS-PAGE and activity assays is recommended to verify protein integrity before use in critical experiments.

How can researchers design experiments to study psbA protein interactions with other photosystem II components?

Studying protein-protein interactions involving psbA requires specialized experimental designs that account for the membrane-integrated nature of photosystem II components:

  • Co-immunoprecipitation studies:

    • Express His-tagged recombinant psbA alongside other photosystem II components

    • Use gentle solubilization with appropriate detergents (e.g., digitonin, DDM)

    • Perform pull-down assays using anti-His antibodies or Ni-NTA resin

    • Identify interacting partners through mass spectrometry analysis

  • Proximity labeling approaches:

    • Generate fusion constructs of psbA with biotin ligase (BioID) or APEX2

    • Express in heterologous systems or reconstituted membranes

    • Activate proximity labeling and identify biotinylated proteins

    • Validate interactions through reverse labeling experiments

  • Microscale thermophoresis (MST) or bio-layer interferometry (BLI):

    • Purify individual photosystem II components

    • Label psbA with fluorescent dyes (for MST) or immobilize on biosensors (for BLI)

    • Measure direct binding affinities and kinetics

    • Determine the effects of mutations or post-translational modifications on interaction strengths

  • Reconstitution experiments:

    • Systematically reconstitute photosystem II complexes with various component combinations

    • Measure functional outputs (oxygen evolution, electron transport rates)

    • Correlate structural interactions with functional outcomes

These approaches provide complementary data about psbA interactions, allowing researchers to build comprehensive models of photosystem II assembly, stability, and function under different physiological conditions.

What controls should be implemented in experiments comparing wild-type and mutant psbA proteins?

Rigorous experimental design when comparing wild-type and mutant psbA proteins requires careful implementation of appropriate controls:

  • Expression and purification controls:

    • Process wild-type and mutant proteins in parallel under identical conditions

    • Verify equal protein purity by SDS-PAGE (>90% purity)

    • Quantify protein concentrations using multiple methods (Bradford assay, BCA assay, and absorbance at 280 nm)

    • Analyze protein folding status using circular dichroism spectroscopy

  • Functional assay controls:

    • Include positive controls with known activity levels

    • Use negative controls with heat-denatured protein

    • Implement concentration gradients to ensure measurements are in the linear response range

    • Test activity under different buffer conditions to identify potential buffer-specific effects

  • Specificity controls:

    • Include related proteins from the photosystem II complex as specificity controls

    • Test unrelated membrane proteins to control for non-specific effects

    • Use competitive binding assays to verify binding site specificity

    • Implement site-directed mutagenesis controls targeting non-essential residues

  • Technical replication strategy:

    • Perform experiments with at least three technical replicates

    • Use protein from independent expression and purification batches (biological replicates)

    • Randomize the order of sample analysis to eliminate systematic bias

    • Blind the experimenter to sample identity when possible

This comprehensive control strategy ensures that observed differences between wild-type and mutant psbA proteins can be attributed specifically to the introduced mutations rather than experimental artifacts or preparation differences.

How does S. bulbocastanum psbA differ from psbA in other Solanum species at the sequence and functional levels?

Comparative analysis of psbA across Solanum species reveals evolutionarily conserved regions essential for function as well as species-specific adaptations:

  • Sequence conservation analysis:

    • The core functional domains of psbA show high conservation across Solanum species

    • S. bulbocastanum psbA contains 344 amino acids, forming the D1 protein of photosystem II

    • Transmembrane domains and quinone-binding pockets display the highest sequence conservation

    • Variable regions typically occur in stromal-exposed loops

  • Functional adaptation differences:

    • Species adapted to different light environments show variations in specific residues that affect:

      • Photodamage susceptibility

      • Repair cycle efficiency

      • Electron transfer rates

    • These adaptations may correlate with the natural habitat of each species (shade vs. sun exposure)

  • Herbicide binding site variations:

    • The psbA protein serves as a target for herbicides

    • Subtle sequence variations in the herbicide-binding pocket can confer differential sensitivity

    • Wild species like S. bulbocastanum may contain natural variations that provide increased tolerance

Researchers studying these differences should employ multiple sequence alignments followed by targeted mutagenesis of divergent residues to assess their functional significance. Recombinant expression systems allow direct comparison of proteins from different species under identical experimental conditions, eliminating confounding variables present in whole-plant studies.

How can researchers leverage S. bulbocastanum psbA protein in comparative stress tolerance studies?

S. bulbocastanum, as a wild potato species, offers valuable genetic resources for stress tolerance studies. Researchers can utilize its psbA protein in comparative analyses using the following methodological approaches:

  • Abiotic stress response characterization:

    • Express recombinant psbA proteins from S. bulbocastanum and cultivated potato varieties

    • Subject proteins to controlled stress conditions:

      • High light intensity

      • Temperature extremes

      • Oxidative stress

    • Measure protein stability, damage accumulation, and repair efficiency

    • Identify specific amino acid differences that contribute to differential stress tolerance

  • Photoinhibition recovery comparisons:

    • Develop in vitro assays measuring electron transport recovery after photoinhibition

    • Compare recovery kinetics between psbA variants

    • Correlate structural features with functional resilience

  • Heterologous expression in model systems:

    • Transform cyanobacteria or green algae with S. bulbocastanum psbA

    • Assess whole-organism photosynthetic efficiency under stress conditions

    • Compare with organisms expressing cultivated potato psbA variants

This research approach can identify specific adaptations in the S. bulbocastanum psbA protein that contribute to stress tolerance, potentially informing genetic engineering strategies to enhance crop resilience in the face of climate change challenges.

What insights can structural modeling of S. bulbocastanum psbA provide for protein engineering applications?

Structural modeling of S. bulbocastanum psbA offers valuable insights for protein engineering applications aimed at enhancing photosynthetic efficiency or stress tolerance:

  • Homology modeling methodology:

    • Use the known amino acid sequence of S. bulbocastanum psbA (344 amino acids)

    • Select appropriate photosystem II crystal structures as templates

    • Generate models focusing on:

      • Quinone binding pocket architecture

      • Transmembrane helix arrangements

      • Protein-pigment interaction sites

      • Potential post-translational modification sites

  • Structure-function correlation analysis:

    • Map conserved vs. variable regions onto the structural model

    • Identify residues involved in:

      • Electron transport

      • Protein-protein interactions

      • Stability under stress conditions

    • Correlate these with known resistance mechanisms in S. bulbocastanum

  • Rational design targets:

    • Based on the structural model, identify candidate sites for:

      • Enhancing electron transport efficiency

      • Improving repair cycle kinetics

      • Reducing photodamage susceptibility

      • Modifying herbicide binding without affecting function

  • Validation approaches:

    • Generate predicted mutations in recombinant protein

    • Test functional outcomes in controlled assays

    • Refine models based on experimental results

    • Develop iterative design-test cycles

This structure-guided approach can accelerate the development of improved photosynthetic systems with applications in both basic research and agricultural biotechnology, potentially contributing to crops with enhanced yield under challenging environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.