Recombinant Solanum lycopersicum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2 (HMG2)

Shipped with Ice Packs
In Stock

Description

Introduction

3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGR) is a crucial enzyme in the mevalonate pathway, which is responsible for the synthesis of isoprenoids, a diverse class of compounds essential for plant growth, development, and defense. In tomatoes (Solanum lycopersicum), two HMGR isoforms, HMG1 and HMG2, are known to exist, each exhibiting distinct expression patterns and regulatory functions . Specifically, HMG2 expression is activated during fruit maturation and increases strongly during ripening, in parallel with the accumulation of lycopene . Recombinant HMG2 refers to the HMG2 enzyme produced using recombinant DNA technology, allowing for detailed study and manipulation of its function.

Gene Expression and Regulation

HMG1 is highly expressed during the early stages of fruit development, when sterol biosynthesis is required for membrane biogenesis during cell division and expansion . HMG2 expression is not detectable in young fruit but is activated during fruit maturation and increases strongly during ripening, in parallel with the accumulation of lycopene .

The expression of HMG1 and HMG2 can be modulated by arachidonic acid (AA) during fruit growth . AA represses HMG1 and induces HMG2 expression in tomato leaves, stems, and fruit discs . The lower level of HMG1 transcripts in AA-treated young fruit is correlated with growth inhibition . In mature fruit, AA strongly and prematurely induced expression of HMG2 and PSY1, as well as lycopene synthesis .

Role in Isoprenoid Biosynthesis

The regulation of HMG1 and HMG2 expression in tomato is consistent with the theory that levels of the different HMGR isozymes in plants are modulated in response to specific developmental and stress signals . It is likely that this results in the channeling of mevalonic acid to specific end products of the isoprenoid pathway . Although results suggest that the control of cytoplasmic isoprenoid synthesis can be exerted at the level of HMG1 and HMG2 expression, the activity of their enzymes in tomato does not appear to be required for plastid carotenoid production . Instead, based on the induction of PSY1 expression before lycopene accumulation, it is likely that plastid PSY has an important role in channeling GGPP from the HMGR-independent Rohmer pathway into plastid carotenoid production .

Biotechnological Applications

Elicitors are compounds that induce plants to produce secondary metabolites at elevated levels and reduce the processing time required to achieve high product concentrations . Real-time PCR analysis was performed for monitoring the expression level of HMG-CoA reductase during the first 2 weeks of elicitation; a significant enhancement was also observed in the total flavonoids, total phenolics, and radical scavenging activity at 4 M MJ concentration in comparison with control .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. Specify your desired tag type during ordering for preferential development.
Synonyms
HMG2; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2; HMG-CoA reductase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Target Names
HMG2
Target Protein Sequence
MDVRRRSEEPVYPSKVFAADEKPLKPHKKQQQQQEDKNTLLIDASDALPLPLYLTTNGLF FTMFFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFVS RGNNDSWDENDEEFLLKEDSRCGPATTLGCAVPAPPARQIAPMAPPQPSMSMVEKPAPLI TSASSGEDEEIIKSVVQGKIPSYSLESKLGDCKRAASIRKEVMQRITGKSLEGLPLEGFN YESILGQCCEMPIGYVQIPVGIAGPLLLNGKEFSVPMATTEGCLVASTNRGCKAIYASGG ATCILLRDGMTRAPCVRFGTAKRAAELKFFVEDPIKFESLANVFNQSSRFARLQRIQCAI AGKNLYMRLCCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNW IEGRGKSVVCEAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVS AVFIATGQDPAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLN LLGVKGANREAPGSNARLLATVVAGSVLAGELSLMSAISSGQLVNSHMKYNRSTKDVTKA SS
Uniprot No.

Target Background

Function

Function: Catalyzes the synthesis of mevalonate, the precursor for all isoprenoid compounds in plants.

Database Links
Protein Families
HMG-CoA reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Solanum lycopersicum HMG2?

Solanum lycopersicum HMG2 is a full-length protein consisting of 602 amino acids. The protein can be recombinantly expressed with a His-tag using E. coli expression systems for research purposes . The gene contains a distinctive promoter region, a TATA element, a 5' untranslated region with pyrimidine-rich sequences, and a translation start site with an unusual hairpin secondary structure surrounding the initiator ATG codon . This structural arrangement contributes to the unique expression profile and regulation of HMG2 during tomato fruit development and ripening.

How does HMG2 expression change during fruit development in tomatoes?

HMG2 expression follows a specific developmental pattern in tomato fruit:

  • In young developing fruit: HMG2 expression is typically undetectable during early stages of fruit development .

  • During fruit maturation: HMG2 expression becomes activated as the fruit transitions from growth to maturation .

  • During ripening: HMG2 mRNA accumulates to high levels during fruit ripening, with expression patterns coinciding precisely with the synthesis of the carotenoid lycopene .

This temporal expression pattern suggests HMG2 has a specific role in the isoprenoid allocation during fruit ripening, particularly in processes related to carotenoid biosynthesis rather than growth-related phytosterol production.

What are the unique features of the HMG2 promoter that distinguish it from other plant promoters?

The HMG2 promoter exhibits several unusual characteristics that differentiate it from typical plant promoters:

  • Unlike most promoters, the region upstream of the TATA element is not required for high-level expression .

  • The 180-bp region containing the TATA element, 5' untranslated region, and translation start site demonstrates comparable strength to the full-length 35S cauliflower mosaic virus promoter, which is considered a strong constitutive promoter in plant systems .

  • Pyrimidine-rich sequences in the 5' untranslated leader play a critical role in regulating expression .

  • The ATG start region significantly enhances translation efficiency by a factor of 4 to 10 .

  • An alternative hairpin secondary structure has been identified surrounding the HMG2 initiator ATG, potentially participating in translational regulation .

These characteristics classify HMG2 as a novel type of strong plant promoter that incorporates unusual positive regulators of gene expression.

How do pyrimidine-rich sequences in the 5' untranslated region influence HMG2 expression?

The 5' untranslated leader of the HMG2 gene contains pyrimidine-rich sequences that serve as important regulatory elements. These sequences significantly impact gene expression through several mechanisms:

  • Transcriptional regulation: The pyrimidine-rich regions may serve as binding sites for transcription factors that enhance RNA polymerase activity.

  • mRNA stability: These sequences can influence the half-life of the mRNA transcript by affecting its susceptibility to nuclease degradation.

  • Translation efficiency: The pyrimidine-rich sequences may facilitate ribosome loading and scanning, thereby enhancing translation initiation.

What experimental methods can be used to analyze HMG2 promoter activity?

Researchers studying HMG2 promoter activity can employ several methodological approaches:

These methodologies provide complementary information about the functional elements within the HMG2 promoter and their role in developmental regulation.

How can arachidonic acid (AA) be used to manipulate HMG2 expression in experimental settings?

Arachidonic acid (AA) serves as a powerful tool for manipulating HMG2 expression in experimental settings, offering researchers the ability to:

  • Simultaneously modulate both HMG1 and HMG2: AA has the unique ability to repress HMG1 while inducing HMG2 expression in the same tissue, allowing researchers to investigate the differential roles of these isozymes .

  • Methodological application in young fruit:

    • Injection protocol: Young tomato fruits can be injected with approximately 50 μg of AA per fruit.

    • Timing: Expression changes can be observed within 24-72 hours after treatment.

    • Effect: AA blocks fruit growth, inhibits HMG1 expression, and activates HMG2 expression that is normally undetectable at this developmental stage .

  • Methodological application in mature-green fruit:

    • Treatment protocol: Similar injection of 50 μg AA per fruit.

    • Response timeline: HMG2 mRNA accumulation is detected 24 hours after treatment, followed by maximum HMGR activity at 48 hours.

    • Outcomes: AA strongly induces HMG2 expression, PSY1 (phytoene synthase gene) expression, and premature lycopene accumulation before the normal onset of ripening .

This experimental approach provides a valuable alternative to transgenic methods for investigating the specific functions of HMG1 and HMG2 in tomato fruit development and carotenoid biosynthesis.

What are the observable phenotypic effects of manipulating HMG2 expression in tomato fruits?

Experimental manipulation of HMG2 expression produces distinct phenotypic effects depending on the developmental stage of the fruit:

In young developing fruit:

  • AA-induced ectopic expression of HMG2 coincides with growth inhibition .

  • Despite activated HMG2 expression, the fruits fail to develop normally, suggesting that HMG2 cannot functionally compensate for reduced HMG1 activity in young fruit .

  • This observation supports the hypothesis that HMG1 and HMG2 have distinct physiological roles related to different isoprenoid end-products.

In mature-green fruit:

  • AA treatment leads to visible lycopene accumulation in approximately 75% of treated fruits within 72 hours, while control fruits remain green .

  • Quantitative measurements show that the amount of lycopene in AA-treated fruits is approximately three times higher than in control fruits .

  • These fruits develop red coloration before the normal onset of ripening, demonstrating premature activation of the carotenoid biosynthesis pathway.

These phenotypic responses provide valuable insights into the stage-specific functions of HMG2 and its relationship to developmental processes and metabolic pathways in tomato fruits.

How can researchers measure HMG2 activity in experimental settings?

Researchers can employ multiple complementary approaches to measure HMG2 expression and activity:

  • Transcript level analysis:

    • Northern blot analysis or quantitative RT-PCR to detect and quantify HMG2 mRNA accumulation.

    • These methods can track temporal changes in expression following experimental treatments .

  • Total HMGR enzyme activity assay:

    • Measure the conversion of HMG-CoA to mevalonate using radioactive substrates.

    • This approach quantifies the combined activity of all HMGR isozymes but cannot distinguish between HMGR1 and HMGR2 activities specifically .

  • Indirect assessment of HMG2 function:

    • Measure downstream metabolites like lycopene using spectrophotometric or HPLC methods.

    • Combined with HMGR inhibitors like mevinolin, this approach can help determine the relationship between HMG2 expression and metabolic outcomes .

  • Recombinant protein production:

    • Express recombinant HMG2 with affinity tags (e.g., His-tag) in E. coli systems .

    • Purify the protein using affinity chromatography for in vitro activity assays.

It's important to note that current methods cannot directly measure the specific activity of HMGR2 separate from HMGR1 in plant tissues . This remains a technical challenge in the field.

What is the relationship between HMG2 expression and carotenoid biosynthesis in tomato fruit?

The relationship between HMG2 expression and carotenoid biosynthesis in tomato fruit is complex and exhibits several key characteristics:

  • Temporal correlation: HMG2 expression increases strongly during fruit ripening in parallel with lycopene accumulation, suggesting a coordinated regulation .

  • Experimental evidence of relationship:

    • Premature induction of HMG2 by AA treatment in mature-green fruit leads to early lycopene accumulation.

    • AA treatment also induces PSY1 (phytoene synthase) expression, a rate-limiting enzyme in carotenoid biosynthesis .

  • Metabolic independence:

    • Surprisingly, inhibition of HMGR enzyme activity using mevinolin does not prevent AA-induced lycopene accumulation .

    • This indicates that while HMG2 expression correlates with carotenoid synthesis, cytoplasmic HMGR activity is not directly required for carotenoid biosynthesis.

  • Mechanistic interpretation:

    • HMG2 may primarily function in pathways other than the direct precursor supply for carotenoids.

    • The correlation between HMG2 expression and carotenoid synthesis might reflect a coordinated developmental program rather than a direct metabolic dependency.

These findings challenge the simplistic view that HMG2 directly regulates carotenoid biosynthesis through the cytosolic mevalonate pathway and suggest more complex regulatory relationships.

How do HMG1 and HMG2 functionally differ in tomato fruit development?

HMG1 and HMG2 exhibit distinct expression patterns and functions during tomato fruit development:

FeatureHMG1HMG2
Expression timingHighly expressed during early stages of fruit developmentNot detectable in young fruit; activated during fruit maturation and increases during ripening
Associated processesSterol biosynthesis required for membrane biogenesis during cell division and expansionExpressed in parallel with carotenoid (particularly lycopene) accumulation
Response to AARepressed by arachidonic acid treatmentInduced by arachidonic acid treatment
Effect on fruit growthInhibition of HMG1 correlates with growth arrestEctopic expression cannot rescue growth inhibition
Proposed metabolic rolesPrimarily involved in phytosterol production needed for growthAssociated with processes occurring during fruit ripening

These differences suggest that the two HMGR isozymes have evolved to regulate distinct branches of the isoprenoid pathway, with HMG1 primarily supporting growth-related processes and HMG2 potentially playing roles in ripening-associated metabolism . This functional specialization represents an important adaptation for controlling the complex isoprenoid metabolism in plants.

What is the impact of mevinolin inhibition on HMG2 function and carotenoid synthesis?

Mevinolin, a specific inhibitor of HMGR enzyme activity, has been used to investigate the relationship between HMG2 function and carotenoid synthesis:

  • Experimental approach:

    • Mature-green tomato fruits were treated with AA to induce HMG2 expression and premature lycopene synthesis.

    • Some fruits were simultaneously treated with mevinolin to inhibit HMGR enzymatic activity.

  • Key findings:

    • AA treatment led to strong induction of HMG2 mRNA followed by increased HMGR enzyme activity.

    • Despite inhibition of HMGR activity by mevinolin, AA-induced lycopene accumulation was not prevented .

  • Metabolic implications:

    • This unexpected result suggests that cytoplasmic HMGR activity is not directly required for carotenoid biosynthesis in tomato fruit.

    • Carotenoids (including lycopene) are synthesized in plastids through the methylerythritol 4-phosphate (MEP) pathway, which is separate from the cytosolic mevalonate pathway where HMGR functions.

    • The correlation between HMG2 expression and lycopene accumulation may reflect coordinated regulation rather than a direct metabolic dependency.

  • Research significance:

    • These findings challenge the assumption that manipulating cytosolic HMGR activity will directly impact carotenoid production.

    • They highlight the importance of understanding pathway compartmentalization and cross-talk in plant isoprenoid metabolism.

This work demonstrates the value of pharmacological approaches combined with gene expression analysis to unravel complex metabolic relationships in plant systems.

How can recombinant Solanum lycopersicum HMG2 protein be effectively produced for research applications?

Recombinant production of Solanum lycopersicum HMG2 involves several methodological considerations:

  • Expression system selection:

    • E. coli is the most commonly used expression system for recombinant HMG2 production .

    • The full-length protein (amino acids 1-602) can be successfully expressed in bacterial systems.

  • Construct design considerations:

    • Addition of affinity tags (particularly His-tags) facilitates purification .

    • Codon optimization for E. coli expression may improve yield.

    • Including the ATG start region from the native gene may enhance translation efficiency by 4-10 fold, as this region has been shown to significantly impact expression levels .

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins.

    • Size exclusion chromatography to ensure protein homogeneity.

    • Careful buffer selection to maintain enzyme stability.

  • Activity validation:

    • Spectrophotometric assays measuring the conversion of HMG-CoA to mevalonate.

    • Analysis of substrate binding using isothermal titration calorimetry.

    • Structural integrity assessment using circular dichroism spectroscopy.

  • Storage considerations:

    • Addition of reducing agents to prevent oxidation of critical cysteine residues.

    • Glycerol addition (typically 10-20%) to prevent freeze-thaw damage.

    • Aliquoting to minimize repeated freeze-thaw cycles.

These methodological approaches enable researchers to produce active recombinant HMG2 for enzymatic studies, structural analysis, and as standards for expression analysis.

What experimental strategies can resolve contradictory findings about HMG2's role in carotenoid biosynthesis?

The apparent contradiction between HMG2 expression correlating with lycopene accumulation while HMGR inhibition does not prevent carotenoid synthesis requires sophisticated experimental approaches:

  • Compartmentalization studies:

    • Subcellular fractionation to determine the precise localization of HMG2 protein.

    • Immunogold electron microscopy to visualize HMG2 distribution relative to carotenoid-producing plastids.

    • Creation of fluorescent protein fusions to track HMG2 localization in living cells.

  • Metabolic flux analysis:

    • Use of isotope-labeled precursors to track carbon flow through the MVA versus MEP pathways.

    • Quantification of intermediate metabolites in both pathways following HMG2 manipulation.

    • Measurement of cross-talk between cytosolic and plastidial isoprenoid pathways.

  • Genetic approaches:

    • CRISPR/Cas9-mediated precise editing of HMG2 catalytic residues to create enzymatically inactive but structurally intact proteins.

    • Conditional silencing of HMG2 using inducible RNAi to separate developmental effects from direct metabolic impacts.

    • Creation of HMG2 variants with modified subcellular targeting to test functional hypotheses.

  • Integrative omics:

    • Correlation of transcriptome, proteome, and metabolome data following HMG2 manipulation.

    • Network analysis to identify regulatory relationships beyond direct metabolic connections.

    • Comparison of data from normal development versus experimental manipulation to distinguish correlation from causation.

These multifaceted approaches can help distinguish between direct metabolic roles, regulatory functions, and coincidental correlations in understanding HMG2's relationship to carotenoid biosynthesis.

How can understanding of HMG2 regulation inform metabolic engineering strategies for enhanced carotenoid production?

Knowledge of HMG2 regulation provides several insights for metabolic engineering of carotenoid biosynthesis:

  • Promoter engineering applications:

    • The unique structural features of the HMG2 promoter, particularly the 180-bp region containing the TATA element, 5' untranslated region, and translation start site, offer powerful tools for driving transgene expression .

    • This compact promoter region demonstrates strength comparable to the widely used 35S cauliflower mosaic virus promoter but with developmental specificity.

    • The ATG start region, which enhances translation efficiency by 4-10 fold, could be incorporated into expression constructs to boost protein production .

  • Coordinated pathway regulation:

    • The observed coordination between HMG2 expression and PSY1 (phytoene synthase) suggests regulatory connections that could be exploited .

    • Transcription factors or signaling components that simultaneously activate multiple genes in carotenoid biosynthesis could be identified and manipulated.

  • Elicitor-based approaches:

    • Arachidonic acid's ability to induce premature lycopene accumulation provides a non-transgenic approach to boost carotenoid production .

    • Screening for additional elicitors that trigger similar responses could identify commercially viable treatments.

  • Pathway compartmentalization considerations:

    • The finding that cytosolic HMGR activity is not required for carotenoid biosynthesis highlights the importance of targeting engineering efforts to the plastidial MEP pathway .

    • Efforts to enhance cross-talk between cytosolic and plastidial pathways might provide novel strategies for increasing flux toward carotenoids.

These strategies, informed by fundamental understanding of HMG2 regulation and function, offer promising approaches for enhancing nutritionally valuable carotenoid production in tomato and other crops.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.